KEGG   Exiguobacterium antarcticum: Eab7_2752Help
Entry
Eab7_2752         CDS       T02258                                 

Definition
(GenBank) Thermolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
ean  Exiguobacterium antarcticum
Brite
KEGG Orthology (KO) [BR:ean00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ean01002]
    Eab7_2752
Enzymes [BR:ean01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     Eab7_2752
Peptidases [BR:ean01002]
 Metallo Peptidases
  Family M4: thermolysin family
   Eab7_2752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 PepSY FTP
Motif
Other DBs
NCBI-ProteinID: AFS71833
UniProt: K0AE09
LinkDB All DBs
Position
2711316..2712812
Genome map
AA seq 498 aa AA seqDB search
MKKFLATSLVASVLVVPTVVGAEGLQSGKLTKASSEPAASIVKEYVNKKGDFSVQDVQKD
GSSNIVRLQQEVDGVPVFGSVVVGNVAKDGTLKAVVNDAINVKGKPGLAKKATISEKKAL
KLYKKAIKATEFEVAPKAELVIYPVKNDAVYAYKITSTVLAGKEPSRWTYFIDANSGKVI
NKFDQLAHATGTTVLGTSATFNTTLSAGKYYLQDTTRGKGVYTYDAKNRTSLPGTLWADA
DNVFNATYDRAAVSAHVNAAKTYDFYKNTYGRNSYDNAGARLNSTVHYSTNYNNAFWDGT
KMVYGDGDGTTFVALSGALDVVAHELTHAVTEYTAGLVYQNESGAINEAVSDIMGTVAEY
SVGSNFDWLVGEDIYTPGVSGDALRSMSNPAAYGDPDHYSKRYTGTQDNGGVHINSGIVN
KSAYLLANGGTFYNVSVTGIGVPKLGAIYYRALNVYLTPNSNFSSLRAAVIQSAKDLYGS
TSAEATAAAKSFDAVGVY
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagtttctcgctacatcgcttgtcgcaagtgtacttgtcgttcctacagtcgtc
ggagcagaaggtcttcaatctggtaagctgacgaaagcttcatcagaacccgctgcatcg
atcgtcaaagagtacgtgaacaaaaaaggtgatttctctgtccaagatgtccaaaaagat
ggatcttctaacatcgtacgtctccaacaagaagtggatggcgtcccggtcttcggtagt
gtcgtcgtcggtaacgttgcgaaagacggtacattaaaagcagtcgtcaacgacgcaatc
aacgtcaaagggaaaccaggtcttgctaaaaaagctaccatctctgaaaagaaagcactc
aaactatacaaaaaagctatcaaagcaactgaattcgaagtggctccaaaagctgaactc
gtcatctatcctgtaaaaaatgacgcagtctatgcttacaaaatcacatctacggtctta
gcaggcaaagagccgtcacgctggacgtacttcatcgatgcgaattcaggtaaggtcatc
aacaaattcgaccaactggctcacgcaacaggtacgacagtacttggaacaagcgcaacg
ttcaacacgacgttgagtgctgggaaatactatcttcaagatacgacgcgcggaaaaggt
gtttacacatacgacgcgaaaaaccgtacatcacttccgggaacactctgggcagatgcg
gataacgtctttaacgctacttacgatcgtgctgccgtcagtgcacacgtcaacgcagca
aaaacgtatgacttctataaaaacacgtacggccgtaacagttatgacaatgcaggcgca
cgcttgaattcgacggtccattactcgacgaactacaacaacgcgttctgggatggaacg
aagatggtttacggtgatggtgacggaacaacattcgtcgctctctctggtgcacttgac
gtcgttgcgcacgaattgacacacgctgtcacagaatacacagctggtctcgtctatcaa
aatgaatctggggcgatcaacgaagcagtttccgatatcatgggtacggttgccgagtac
tctgtcggatcaaacttcgactggctcgttggtgaagacatctacacgccaggtgtcagc
ggtgacgcactccgttcaatgtcgaacccggcagcttacggtgatccggaccactactca
aaacgctacacaggaacgcaagataacggtggtgtccacatcaactctggtatcgtcaac
aaatcagcgtacctccttgcaaacggcggcacattctacaatgtatccgttacaggaatc
ggtgtaccgaaacttggtgcgatctactaccgtgcgcttaacgtctacttgactccgaac
tcgaacttcagctcacttcgtgcggcagtcattcagtcagcaaaagatctttacggttca
acaagtgcagaagcaacagcagcagcgaaatcatttgatgctgtcggcgtctactaa

DBGET integrated database retrieval system