KEGG   Exiguobacterium antarcticum: Eab7_2810Help
Entry
Eab7_2810         CDS       T02258                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ean  Exiguobacterium antarcticum
Brite
KEGG Orthology (KO) [BR:ean00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Eab7_2810
Enzymes [BR:ean01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Eab7_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_oxidored GIDA FAD_binding_2 HI0933_like DAO AlaDh_PNT_C NAD_binding_8 FAD_binding_3 Thi4 K_oxygenase Glutaredoxin Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: AFS71890
UniProt: K0AGE9
LinkDB All DBs
Position
2769886..2771415
Genome map
AA seq 509 aa AA seqDB search
MALAADIKAQLAQYLELLEGDLVLAVSAGTDSVSLEMSELVEEIASMSPRISIEQATLPR
TPSFSVNRVGEESGITFAGIPLGHEFTSLVLALLQVSGRAPKVDAALIEQIKGIKETYHF
ESYISLSCHNCPDVVQALNVMSVLNPNISHTMIDGGAFKQEVEAKEIMAVPTVFVNGEAF
GNGRMSLEEILAKLGTGVDASDFADKDPYDVLVVGGGPAGSSAAIYAARKGIRTGIVAER
FGGQVMDTMSIENFISMKYTEGPKLVASLEEHVKEYGIDVMNLQRAKRLEKKDLVELELE
NGAVLKTKSLILSTGARWRNIGVPGELEFKNKGVAYCPHCDGPLFEGKRVAVIGGGNSGV
EAAIDLAGLVKHVTVLEFAPELKADAVLQDRLASLPNVTVVANAQTKEITGTDKVNGITY
VERETGAEYHVELEGVFVQIGLVPNTDWLGETIERNKFGEILVDRHGATNIPGVFAAGDC
TDSAYKQIIISMGSGATAALGAFDYMIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggctttagcagcagacattaaagcacaactcgctcaatatttagagttattagaagga
gatcttgtcctcgcggtcagcgccgggacagactccgtttctcttgagatgagcgaactc
gtcgaagaaatcgcgagcatgtcaccacggatcagcatcgaacaagcaacactgccgcgg
acaccaagcttcagcgtcaatcgtgtcggtgaagagagcgggatcacgtttgccgggatt
ccacttggtcatgagttcacgtcgctcgtcttggcgttactccaagtcagtggtcgtgca
ccaaaagtcgatgcagcattgatcgaacagatcaaaggcattaaagaaacataccacttc
gagtcctacatcagtctcagttgccacaactgtccggatgtcgtccaagccttgaacgtc
atgagtgtcctgaacccgaacatcagccatacgatgattgatggtggcgcgtttaaacaa
gaagtcgaagcgaaagaaatcatggctgtcccaacggtcttcgtcaacggcgaagcgttc
ggaaacggtcggatgtcactcgaagaaattcttgcgaaactcggcacaggtgtcgatgcg
tctgactttgcggacaaagatccgtacgacgtccttgtcgtcggtggaggtcctgctggt
tcaagtgccgcgatttatgcagcccgtaaaggcatccggaccgggatcgtcgcggaacgg
tttggcggtcaggtcatggatacgatgagcatcgagaacttcatcagcatgaagtatacg
gaaggtccgaaactcgttgcgagtcttgaagaacacgtcaaagagtacggcatcgatgtc
atgaacctccagcgggcaaaacgtcttgagaaaaaagacctcgtcgaactggaacttgag
aacggtgcggtcttgaaaacgaaaagtctgatcctctcaacaggagcacgctggcgcaac
atcggtgtaccgggcgaactcgagttcaagaacaaaggggttgcgtactgtccccactgt
gacggtccactcttcgaaggaaaacgtgtcgctgtcatcggcggcgggaattccggtgtc
gaagctgcgatcgatcttgccggtctcgtcaaacatgtgacggtgcttgaatttgcaccg
gaactgaaagcagacgcggtcttacaagaccgtctggcaagtcttccgaacgtcacggtc
gttgccaacgcccagacgaaggaaatcacaggaacagacaaagtgaacggcatcacgtat
gtcgaacgcgaaacaggtgctgagtaccatgtcgagctcgaaggtgttttcgtccagatt
ggtcttgtgccaaacacagactggctcggcgaaacgatcgaacgcaacaagttcggtgaa
atccttgtcgatcgtcatggcgcaacgaacatcccgggtgtcttcgcagccggtgactgt
acggacagtgcttacaaacagatcatcatctcgatgggatcaggtgctacagctgcactc
ggtgccttcgattacatgattcgtaactga

DBGET integrated database retrieval system