KEGG   Elizabethkingia anophelis NUHP1: BD94_0022Help
Entry
BD94_0022         CDS       T03235                                 

Definition
(GenBank) Superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
eao  Elizabethkingia anophelis NUHP1
Brite
Enzymes [BR:eao01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BD94_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD Big_3_5
Motif
Other DBs
NCBI-ProteinID: AIL43797
UniProt: A0A077E841
LinkDB All DBs
Position
complement(21011..21520)
Genome map
AA seq 169 aa AA seqDB search
MKNLKILSLGILGAVFTVSCATKEVSYAITPKSGTATGGTVTFKQMGKNVVMNVDAKGLT
PGVHAIHIHDKPDCSAPDGTSTGGHWNPAGSDHGKWGAEHFHMGDIGNLNADDKGNAKLT
FKTSKWCIGCTDETKNILNHGLIIHAAADDFHTQPTGNAGGRVGCVEIK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaaaaatattatccttaggcattctgggagctgtatttacagtttcgtgt
gctactaaggaggtaagttatgctattacccctaaaagtggaacagcaacaggaggaacc
gtaacctttaaacagatgggcaaaaatgtagtcatgaatgttgatgcaaagggattaacg
ccaggagtacatgctattcacatccatgataagccagattgttcagctccagacggaaca
tctacgggtggacattggaaccctgcaggaagcgaccatggaaaatggggagcagaacat
ttccatatgggtgatataggtaaccttaatgctgacgataagggtaatgcaaaattaact
tttaaaacaagcaaatggtgtattggttgtacagatgaaacaaagaatatcctgaatcac
ggattaatcattcatgcagctgctgacgatttccatactcagcctacgggaaatgcaggc
ggaagagttggatgtgttgagattaaataa

DBGET integrated database retrieval system