KEGG   Elizabethkingia anophelis NUHP1: BD94_1758Help
Entry
BD94_1758         CDS       T03235                                 

Definition
(GenBank) Manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
eao  Elizabethkingia anophelis NUHP1
Brite
Enzymes [BR:eao01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BD94_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIL45533
UniProt: A0A077EG24
LinkDB All DBs
Position
1843450..1844130
Genome map
AA seq 226 aa AA seqDB search
MKLFGAATLGFALVAQLVSAQFKQAPLPYAYNALEGSIDAQTMEIHYSKHGAAYVANLNK
AIAGTSLEKESLVKILSGISKQSPAIRNNAGGHYNHELFWTILTPEKNTQPSEKLAKAIN
QSFGSFDAFKEKMSKAGADRFGSGWAWLIVTPEKKLAITSTANQDNPLMDIAEVKGIPVL
GIDVWEHAYYLKYQNKRADYLSAIWNVINWKEINKRYEAALNGKTE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatttggagcagccacactaggatttgcacttgtggcacagctggtatcagca
caattcaagcaagcaccattaccttatgcttataatgcactggaaggatcaattgatgca
caaacaatggaaatacattacagtaagcacggtgcggcatatgtagcaaacctaaataag
gctattgcgggaacatctttggaaaaagaaagtcttgtgaaaatactttccggaatctca
aaacagagcccggcgataagaaacaatgccggtggccattataaccatgagctattctgg
acaatccttactcctgaaaagaatactcaaccatcggagaaactagcaaaagctattaat
cagtcttttggtagtttcgatgcctttaaagaaaaaatgagtaaagccggagcagatcgt
tttggttccggttgggcatggcttattgttacgccggagaaaaaattagcaattacttct
actgcaaatcaggataacccattaatggatattgctgaggtgaaaggtatacctgtttta
ggaattgatgtttgggaacacgcctattacctgaagtatcagaataaaagagctgattac
ctcagcgctatctggaatgtaatcaactggaaagagattaataagcgatatgaagctgcc
ctaaacggaaaaactgaataa

DBGET integrated database retrieval system