KEGG   Elizabethkingia anophelis NUHP1: BD94_2008Help
Entry
BD94_2008         CDS       T03235                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
eao  Elizabethkingia anophelis NUHP1
Pathway
eao00620  Pyruvate metabolism
eao00680  Methane metabolism
eao01100  Metabolic pathways
eao01120  Microbial metabolism in diverse environments
eao01200  Carbon metabolism
Module
eao_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:eao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BD94_2008
  09102 Energy metabolism
   00680 Methane metabolism
    BD94_2008
Enzymes [BR:eao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BD94_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4070
Motif
Other DBs
NCBI-ProteinID: AIL45783
UniProt: A0A077EGU4
LinkDB All DBs
Position
2113013..2115550
Genome map
AA seq 845 aa AA seqDB search
MKTNEQVEKFRQIVKNKFQIYNSLFMSLPYDKMTNIGMLLPFLHEESKEGYENGKSPMEV
MKHFFDSHTDLKTEEERIDLLFRIIQYVERQVVLFDSIEDSAFSTLNANTDPGTVRNLYE
VASQQGKLHIIKEKMEHFGVKVVFTAHPTQFYSNSVQSILHDLNQAIKSDSVTNIDMLLQ
QLGMTSFINQEKPTPYDEAQSIIYYLRYVYYDTLGELYRDTKRVFDDAHINPHLFQLGFW
PGGDRDGNPFVTSEITQRVSSELRLAILKCYYEHLKKLRKRITFPRVTEMLRLISERVYQ
NIFENKYDLTAGEFKKALQDIRHEVKENNNGLFIDKIDDLLGRIDLFGIYFASLDIRQNS
KIHYKALEQIFEKEFCKDYHALGDDEKLNLLLNTSLHVNPEDYSDDIVQDTLKNIYQVKE
IQKINGEKSIHRYIISDSSSIYDVLNVYALFKYCGYQGEDIKIDIVPLFETIEGFENAEA
TMKKLYNLSQYKEHLTRRSDRQFIMLGFSDGTKDAGYIKANWDIYTTKEVLTKVSDENDI
KVIFFDGRGGPPARGGGKTHQFYASQGKSIANHQIELTIQGQTITSVFGTKDQATFNFEQ
LLTAGIENEIFPQDKINLKDWERDLLNELAGISYQKYKALKDHPLFVPYLEEVSTLKYYG
RTNIGSRPSKRNDGQLVFEDLRAIPFVGSWSLLKQNVPGYFGVGTALQRLKEEGRLEDLK
KLYRESMFFKTLIQNSMMSMSKTYFPLTYYLRNDKIFGEFWQILHNEYLLTHEMLLEIAN
YKSLMEEEPLSKSSIKMRENIVLPLLTIQQYALQKIKEENPHKETYEKIVTRALFGNINA
SRNSA
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaatgaacaagtagaaaaattcagacaaattgtaaaaaacaaatttcagatc
tataatagccttttcatgagccttccgtatgataaaatgaccaacatcggaatgcttttg
ccttttctccatgaggaaagtaaagaaggctatgaaaatggaaaatctccaatggaggta
atgaaacatttcttcgacagccatacagatttgaaaactgaagaagaaagaatagatctt
ctgtttcgtataattcagtatgtagaaagacaggtagtattattcgatagtattgaagat
tctgcattttccacattaaatgctaatacagatccaggaacagttcgtaatttgtacgaa
gtggcatctcaacagggaaagctgcatattattaaagaaaaaatggaacattttggtgtt
aaggttgttttcacagcacacccgacacaattttattccaattcagtgcaatccattctc
catgatctgaatcaggctataaagtccgattcagttaccaatatagatatgctgttgcaa
cagttggggatgacttcattcatcaaccaggaaaagccaacgccttatgatgaagcccaa
agtattatctattatctgcgctatgtttattacgatactttaggagagctctatcgggat
accaaacgtgtttttgatgatgcacatataaatccgcatttgtttcagttaggcttttgg
ccgggaggcgatagagatggaaatccctttgtaacatcagaaattactcagcgggtatca
tcagaattaagacttgctattcttaaatgttattatgaacatcttaagaaactccgcaag
agaattactttcccaagagttacagaaatgctgagactaattagtgaaagggtgtaccaa
aatattttcgaaaacaaatatgatcttactgccggagaatttaagaaagctttacaggat
ataagacatgaggtaaaagaaaataataatggtttattcattgataaaattgatgattta
ttaggacgcatagacctgttcggaatttactttgcttcacttgatattcgccaaaacagt
aaaatccattacaaggccttagagcagatttttgaaaaagaattttgcaaagattatcat
gctttgggtgatgatgaaaaactgaatttacttctgaatacatcattacatgttaatccg
gaagattatagtgatgatatagtacaagacactctgaaaaatatctatcaggtaaaagaa
attcaaaagataaacggagaaaaaagtatacaccgttatattatttcagacagttcctct
atttatgatgttctgaatgtttatgcattatttaaatattgtggttatcagggtgaggat
ataaaaattgatattgtgccattgtttgaaaccatagaaggctttgagaatgcagaagca
acaatgaaaaaactttataatctctctcagtataaagaacatcttacccgccgtagtgat
cgtcagtttattatgctggggttctctgacggaactaaagatgccggttatattaaagca
aactgggatatttatacaaccaaggaagtacttacaaaagtttcggatgaaaatgatatt
aaagttatattctttgatggtagaggagggccgccggcaagaggaggcggaaagactcac
cagttttatgcttcacaaggaaaaagtatcgcgaatcatcagatagaattaacaattcag
gggcaaacaattaccagtgtcttcgggacaaaggatcaggcaactttcaacttcgagcaa
ttattaacagcaggtattgaaaatgaaattttccctcaggataagattaatcttaaagac
tgggaaagagatttgctaaatgagcttgccggaattagttatcagaaatataaagcactg
aaagatcatccgctttttgtaccatatctggaagaagtcagtacactaaaatattatggg
cgtactaatatcggaagtcgtccgagtaaaaggaatgatggtcaactggtattcgaagat
ctaagagctattccgtttgtgggatcatggagtttgttaaagcaaaatgtgcctggatat
tttggcgtgggtacggctttacaaagattaaaagaagaaggaagactggaagatcttaaa
aagctatacagagagtctatgttctttaagacacttattcagaatagtatgatgtctatg
agtaaaacttattttccgttgacttactatttgcgtaatgataaaatatttggtgaattt
tggcagatcctgcataatgaatacctgctgacccatgaaatgcttttggaaatagccaat
tacaaatctctgatggaagaagaaccattgtctaaaagctccatcaaaatgagagagaac
attgtactaccattactaaccattcagcaatatgctttacaaaagattaaagaagagaat
ccgcataaagaaacctatgaaaagattgttacaagagcattatttggaaacattaatgcc
agtcgtaattcggcataa

DBGET integrated database retrieval system