KEGG   Klebsiella aerogenes EA1509E: CCG29968Help
Entry
CCG29968          CDS       T02447                                 

Definition
(GenBank) Cell division protein FtsI [Peptidoglycan synthetase] (EC 2.4.1.129)
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
ear  Klebsiella aerogenes EA1509E
Pathway
ear00550  Peptidoglycan biosynthesis
ear01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ear00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CCG29968
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CCG29968
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ear01011]
    CCG29968
Enzymes [BR:ear01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CCG29968
Peptidoglycan biosynthesis and degradation proteins [BR:ear01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CCG29968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CCG29968
LinkDB All DBs
Position
1223118..1225037
Genome map
AA seq 639 aa AA seqDB search
MALLRDEIRDHSAEEMLFIRRAVIAFLLVVVCFGVLIFNLYHLQVEQHDFYQTRSNQNDI
KMLPIAPSRGLIFDRNGIPLVQNITLYRLQVIPSKIADMSALLQALSPIVDLTADDIASF
RDDMHHNSRYKEVTLKSDLTDVEVARFAVNEFRFPGVTVESYQQRSYPYGAELAHVVGYV
SKINDNDLQRLAKNGEAENYAADRNIGKQGIEGYYEKELHGTTGYQEVEVDNHGRVVRLL
KEVPPVAGKNIYLTLDLHLQQYIESVLKGQRAAVVAVDPRDGGVLAMVSSPSYDPNPFVK
GIGYQAYKSLLDNQDRPLINRVTQGLYPPASTVKPYMALSALSAGVITPNTTFFGAPTWT
LPGTQRRYRDWLKTGHGMLNVTKAIEESADTFFYQVAFEMGIDRIHEWLSKFGYGQSTGI
DLNEEYAGVLPSREWKQRVHKKPWYQGDTISVGIGQGYWIATPIQMVKALTTLINNGKVQ
NPHLLYSMKQGNKVVRYQQPANLPQVGDPKSPYWGVVRNGMYGMANLPNGTGYKLFHTAP
YQIAAKSGTSQVFSLKENQTYNAKMIPVRLRDHIFYTLFAPYQHPKVAMALILENGGGDG
VVAGPTARAILDHIFDPANAPAADSAQSNVPQVESADAQ
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggccctattgagagatgagatccgcgaccactcggcagaagagatgctgtttatccgc
cgcgccgttattgctttcctgttggtggtggtctgctttggggtgttgattttcaatctc
taccatctccaggtagagcagcacgacttttatcagacccgctccaatcaaaatgacatt
aaaatgttgccgatcgcgccaagccgggggctgattttcgaccgcaacggtattccgctg
gtacaaaatatcaccctgtatcgcctgcaggtgatccccagcaagattgccgatatgtcg
gcgctgctgcaggcgttaagcccgattgtcgacctgacggcggatgatatcgccagtttc
cgcgacgatatgcaccacaatagccgctataaagaagtgacgctgaaatccgatcttacc
gatgtggaagtggcgcgattcgcggtcaacgaattccgttttcccggcgtcaccgtcgag
agctaccagcagcgaagttatccctatggcgcggaactggcgcacgttgtcggttacgtt
tcgaaaattaacgataacgatttacaacggctggcgaaaaacggcgaagcagaaaactac
gcggccgatcgcaatatcggtaaacaggggattgaaggctattacgagaaagagctgcat
ggcaccaccggttatcaggaagtcgaggtagacaaccacggtcgcgtcgttcgcctgttg
aaagaagtcccgccggtcgccggcaaaaatatctatctgacgctagacctgcatttgcag
cagtacatcgagtcggtcctgaagggccagcgcgccgcggtcgtggccgtcgacccgcgc
gacggcggcgtactggcaatggtctccagccccagctatgaccccaaccccttcgttaag
gggattggctaccaggcttacaaatcgctgctcgataaccaggatcgcccgctgattaac
cgcgtcactcagggcttgtatcccccggcttccacggtcaagccgtatatggcgctctca
gccctttccgccggggtgattacgccaaataccaccttcttcggcgcgccgacctggacg
ctacccggtactcagcgccgctatcgcgactggttaaaaacgggacatggtatgttgaat
gtgaccaaagcgattgaagagtcggcggataccttcttctaccaggtcgcttttgagatg
ggcatcgaccgtatacacgagtggttgagcaagtttggttacggacaatcgaccggcatc
gatctcaatgaagaatacgccggggttttgccgagccgcgaatggaaacagcgggtacat
aaaaaaccgtggtatcagggcgatacgatttccgtcggtatcggccaggggtactggatc
gcgacgccaatccagatggtgaaagcgctgaccactttaatcaacaacggcaaagtacaa
aacccccatcttttgtactcaatgaagcaggggaataaggtcgtacggtaccagcagcca
gccaatttaccgcaggtcggcgatccgaaatcgccatactggggggttgttcgcaatggt
atgtatggcatggcgaacctgccgaacggtacgggatataagctgtttcataccgcgccg
taccagattgcggcgaagtccggcacctcgcaggtgtttagcctgaaggagaaccagacc
tacaatgccaaaatgatcccggtacgtctgcgcgaccacattttttataccctgtttgcg
ccgtatcagcatccgaaagtggcgatggcgctcattctcgaaaatggcggcggcgatggc
gttgtcgccggcccgacggcgcgtgcgattctcgaccatatcttcgacccggcgaatgcg
ccggctgcggatagcgcgcaaagtaacgttccgcaggtcgaaagcgccgatgcgcagtaa

DBGET integrated database retrieval system