KEGG   Klebsiella aerogenes EA1509E: CCG30049Help
Entry
CCG30049          CDS       T02447                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases
  KO
K22601  oxamate carbamoyltransferase [EC:2.1.3.5]
Organism
ear  Klebsiella aerogenes EA1509E
Pathway
ear00230  Purine metabolism
ear01100  Metabolic pathways
ear01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ear00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CCG30049
Enzymes [BR:ear01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.5  oxamate carbamoyltransferase
     CCG30049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CCG30049
LinkDB All DBs
Position
complement(1306365..1307762)
Genome map
AA seq 465 aa AA seqDB search
MKLYQMTIAGIQQSLSRGEFSARELARQTLDDIAQSNPLLNAWTTVTGKRMLDEADAIDA
LRRTNQPLPALAGVPYAVKNLFDVAGETTLAGAQLFSNNPPARVDSWAVSQIQSAGGLLS
GMLNMDAYAYGFTTENSHYGATRNPHDLNRIAGGSSGGSAAAVAAGLVTFSLGSDTNGSI
RVPASLSGIFGLKPTFGRLSRTGSHPFVPSLDHIGPFARTVEDLATVYDVLQGRDVNDGF
QAERGVAPATPHLRYGLQGLRCAVLGGYFSRWCDDDARAAVARVARYLEASEEFLFPEAE
LARASAFIISASEGGNQYLPALRREPERFEPHSRERLLAGAMIPSAWYLQAQRFRRHAQQ
QVASLFTHADVLIAPATPCSATLIGEQTMEINGESLPIRASMGMLTQPISFIGLPVVTVP
LRTATGLPVGVQLIAAPFNEQACLRAAYALEAMGMTDSRPVEVAA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagctatatcagatgaccattgccgggatccagcagtcgctgagtcgcggtgaattt
agcgccagagagctggctcgccagacgcttgatgatattgcgcaaagtaacccactgctc
aatgcctggacgactgtcaccgggaaacggatgctcgacgaagcggacgccattgatgcc
ctacggcgcacgaatcagccgctacctgcgctggcaggggttccctacgcggtcaaaaat
ctgtttgatgtcgcgggagaaaccacactcgccggcgcgcaactgttcagtaataaccca
cctgcccgcgtcgatagctgggcggtaagtcaaatccaaagcgcaggcggcctgctcagc
gggatgctgaatatggacgcctatgcttacggttttaccacggaaaacagccactatggc
gcgacgcgtaatccgcacgatcttaaccgcattgctggcggatcctccggcggctcagcg
gcggcggtcgccgccgggctggttactttctcgctcggtagcgacaccaatggttcaatc
cgcgttccggcatccctgagcgggatttttggtctcaagccaactttcggccgtctgtcg
cgtaccggcagccacccttttgttcccagcctcgatcatattggtccgtttgcccgaacg
gtagaggatctagccacagtctacgatgttctgcaggggcgagacgttaatgacggtttt
caggccgaacgcggcgtcgcccccgccacgccgcatctgcgatatggcctccaggggctg
cgttgcgcggttttaggcggctatttcagccgctggtgcgatgacgatgcccgcgcggcg
gtggctcgggtcgcccgctatctcgaagcctctgaagagtttctcttccccgaggcggag
ctggcgcgcgcttctgcttttatcattagcgcttctgaaggcggaaaccagtacctgcca
gccttacggcgtgagccggagcgctttgaaccgcactcgcgcgaacgtctgctggcggga
gcgatgatcccttcagcctggtacctgcaggcgcagcgctttcgtcgccacgctcagcag
caagtcgcgtcgctattcacccatgccgacgtgctcatcgccccggcaacaccgtgcagc
gccacgcttattggcgagcagacgatggagatcaacggcgagtctttaccgatacgcgcc
agcatgggcatgcttactcaaccaatctcctttatcggtctgccggtggtgaccgtcccg
ctacgtaccgcgacggggctgcctgtcggggtgcagttaattgccgcgccgtttaatgaa
caggcttgtctgcgcgccgcctatgcgctggaagcgatgggaatgaccgattcccgcccg
gtggaggtagccgcatga

DBGET integrated database retrieval system