KEGG   Klebsiella aerogenes EA1509E: CCG30893Help
Entry
CCG30893          CDS       T02447                                 

Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.60)
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ear  Klebsiella aerogenes EA1509E
Pathway
ear00061  Fatty acid biosynthesis
ear01100  Metabolic pathways
ear01212  Fatty acid metabolism
Module
ear_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ear00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CCG30893
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ear01004]
    CCG30893
Enzymes [BR:ear01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CCG30893
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     CCG30893
Lipid biosynthesis proteins [BR:ear01004]
 Fatty acid synthase
  Component type
   CCG30893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: CCG30893
LinkDB All DBs
Position
2152397..2152717
Genome map
AA seq 106 aa AA seqDB search
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPSMLMMDRVVKMTETGGNYDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLAIWAGWAAKGKAARWA
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacaaaagaagatcttcttgcctctggtcgtggtgaa
ctgtttggcgcgaaaggcccgcaactgccggcgccgagcatgctgatgatggaccgcgtc
gtcaagatgaccgaaaccggcggcaactacgacaaaggttacgttgaagctgagctcgac
atcaacccagacctgtggttcttcggttgtcacttcatcggcgacccggtaatgcctggc
tgtctgggtctggacgcaatgtggcaactggctatctgggctggctgggcggcgaaggga
aaggccgcgcgctgggcgtag

DBGET integrated database retrieval system