KEGG   Klebsiella aerogenes EA1509E: CCG31216Help
Entry
CCG31216          CDS       T02447                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F (EC 1.6.4.-)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ear  Klebsiella aerogenes EA1509E
Brite
KEGG Orthology (KO) [BR:ear00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CCG31216
Enzymes [BR:ear01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CCG31216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Thi4 K_oxygenase DAO NAD_binding_8 FAD_binding_3 Glutaredoxin FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CCG31216
LinkDB All DBs
Position
complement(2496851..2498416)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLAV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRNLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSEYDVDVIDSQSAAKLIPAAVEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVVGD
GSKVTGLQYRDRVSGDEHHVALAGIFVQIGLLPNTNWLEGTVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKSA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcctatcttgagaagctgaccaaacct
gttgagctgattgccacgctggatgacagcgctaaatcggcagagatcaaggaactgttg
gctgaaatcgctgaactgtcagacaaagttacctttaaagaagacaacacgctggcggta
cgtaagccatcgttcctgattactaacccaggttccaaccaggggccgcgttttgctggt
tctcccctgggacatgagttcacctcattagtgctggcgctactgtggaccggcggtcat
ccgtcgaaagaagcgcagtcgctgctggagcagatccgcaaccttgacggtgattttgaa
ttcgagacttactactcgctctcttgccacaactgcccggacgtggtgcaggcgctgaac
ctgatggcggtgctgaatccgcgcatcaaacacacggcgattgatggtggaaccttccag
aatgaaatcaccgatcgcaacgtgatgggcgtaccggcggtgtttgtgaatggtcaggag
tttggtcaaggtcgtatgacgctgactgaaatcgtcgccaaagtggataccggcgcggaa
aaacgcgcggcggaagagctgaacaaacgcgatgcttatgatgttctaatcgtcggttcc
ggcccgtctggcgcagcggcggcggtatactccgcgcgtaaaggcattcgtaccggcctg
atgggcgaacgtttcggcggccaggtgctggatactgtagatatcgaaaactatatttcc
gtaccgaaaaccgaaggccaaaaactggccggcgccctgaaagcgcacgtcagtgaatat
gatgttgatgtgattgattcacaaagcgcggcaaaactgatcccggcagccgtcgaaggt
ggcctgcatcagatcgaaaccgcctccggcgcggtgctgaaagcgcgcagcgttatcatc
gcaaccggcgccaaatggcgtaacatgaacgtgcctggtgaagaccaataccgcactaag
ggcgtaacctactgcccgcactgcgacggcccgttgtttaaagggaaacgtgtggcggtg
attggcggcggtaactctggcgttgaagcggcaattgatttggcgggcgtcgttgaacac
gtgacgttgctggagttcgcgccagaaatgaaagccgaccaggtgctgcaggataaagta
cgcagcctgaaaaatgtcgatattattctcaacgcccagaccaccgaagtggttggcgac
ggtagtaaggtgacggggctgcagtaccgcgaccgcgtcagcggcgatgagcatcatgtc
gcgttagccggtatttttgtccagatcggcctgttgccgaataccaactggctggaaggt
acggttgagcgtaaccgcatgggtgaaatcatcattgatgccaaatgtgaaaccaacgtg
aagggcgtatttgccgccggcgactgcactaccgtgccgtacaaacaaattattatcgcc
actggcgaaggtgcgaaggcttctctgagctcattcgattatctgattcgtaccaaaagc
gcataa

DBGET integrated database retrieval system