KEGG   Klebsiella aerogenes EA1509E: CCG31543Help
Entry
CCG31543          CDS       T02447                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19)
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ear  Klebsiella aerogenes EA1509E
Pathway
ear00250  Alanine, aspartate and glutamate metabolism
ear00280  Valine, leucine and isoleucine degradation
ear00410  beta-Alanine metabolism
ear00640  Propanoate metabolism
ear00650  Butanoate metabolism
ear01100  Metabolic pathways
ear01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ear00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CCG31543
   00650 Butanoate metabolism
    CCG31543
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCG31543
   00280 Valine, leucine and isoleucine degradation
    CCG31543
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCG31543
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ear01007]
    CCG31543
Enzymes [BR:ear01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CCG31543
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CCG31543
Amino acid related enzymes [BR:ear01007]
 Aminotransferase (transaminase)
  Class III
   CCG31543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CCG31543
LinkDB All DBs
Position
complement(2827183..2828466)
Genome map
AA seq 427 aa AA seqDB search
MTSNKALMQRRSDAVPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
EVIAAVEGQLKKLTHTCFQVLAYEPYLQLCEMMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATGRSGTIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGISD
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
NPIACAAALAVLKVFEQENLLEKANQLGDKLRKGLLNIAETHREIGDVRGLGAMIAIELF
EEGDHSKPNAKLTADIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIAQGLKIIADC
FNEAKQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaataaagcgttaatgcagcgccgtagcgacgcggtgccgcgcggcgtcgga
caaattcaccctatctttgccgaccgtgcggagaactgccgggtatgggacgttgaaggc
cgtgaatatctcgatttcgccggcggtatcgcggtgttaaataccggccacctgcatcct
gaggtgatcgccgcggtggaaggccagctgaagaagctgacccacacctgcttccaggtg
ctggcctacgagccctacctgcagctgtgcgaaatgatgaaccagaaagtgcccggcgat
ttcgccaagaaaaccctgctggtgaccaccggttcggaagcggtggaaaacgcggtcaaa
atcgcccgcgcggcgaccgggcgtagcggcactatcgcctttaccggcgcctatcatggc
cgtacccattacaccctctcgttaaccggtaaagtgaacccttactccgcgggcatgggg
ttaatgccgggccacgtttatcgcgcgctctacccgtgcgcgctgcacggtatcagcgat
gatgacgcgatcgccagcatccatcgcatcttcaaaaatgacgccgcgccggaagatatc
gccgctatcgtcatcgaacccgtccagggcgaaggcggtttctacgccgcctccccggcc
tttatgcagcgcctgcgcgcgctgtgcgacgagcacggcatcatgctgatcgccgatgaa
gtccagagcggcgcgggccgtaccggcacgctgttcgcgatggagcagatgggcgtggcg
ccggatatcaccacctttgccaaatccatcgccggcggtttcccgctggcgggcgtcacc
ggacgggcggaagtcatggacgccatcgcgccgggtggattgggcggcacctatgccggc
aacccgattgcctgcgccgccgcgctggcggtactcaaggttttcgaacaggaaaacctg
ttggaaaaagccaatcagctcggcgacaagctgcgtaaaggcctgctcaatatcgccgaa
acacatcgcgaaatcggcgacgtccgcggcctgggggcgatgatcgccattgaactcttt
gaagagggcgatcacagcaaacccaacgccaaactgacggcggatatcgtcgcccgcgcg
cgggataaaggcctgatcctgctctcctgcgggccgtactacaacgtgctgcgtattctg
gtgccgctgactatcgaagatgcgcagatcgcgcagggactgaagattatcgccgactgt
tttaacgaagctaaacaaggctaa

DBGET integrated database retrieval system