KEGG   Klebsiella aerogenes EA1509E: CCG33089Help
Entry
CCG33089          CDS       T02447                                 

Definition
(GenBank) Stringent starvation protein A
  KO
K03599  stringent starvation protein A
Organism
ear  Klebsiella aerogenes EA1509E
Brite
KEGG Orthology (KO) [BR:ear00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ear03021]
    CCG33089
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ear02000]
    CCG33089
Transcription machinery [BR:ear03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     CCG33089
Transporters [BR:ear02000]
 Other Transporters
  Pores ion channels [TC:1]
   CCG33089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 Glutaredoxin GST_C_5 GST_C_6
Motif
Other DBs
NCBI-ProteinID: CCG33089
LinkDB All DBs
Position
4456706..4457344
Genome map
AA seq 212 aa AA seqDB search
MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVP
TLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMQRIEKDWYSLMNTIQTG
TAAQADAARKQLREELQAIAPVFTQKPYFLSDEFSLVDCYLAPLLWRLPVLGVELVGAGA
KELKGYMTRVFERDSFLASLTEAEREMRLGRG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgctgccaacaaacgttcggtaatgacgctgttttctggtcctactgacatc
tatagccatcaggtccgcatcgtgctggccgaaaaaggtgtcagttttgagatagagcac
gtggagaaggataacccgcctcaggatctgattgacctcaacccgaatcaaagcgtcccg
acgctggtggatcgtgagctcactctgtgggaatcccgcatcattatggaatacctggat
gagcgtttcccgcatccgccgctaatgccggtttacccggtggcgcgtggtgaaagccgt
ctgtacatgcaacgtatcgagaaagactggtattcgctgatgaataccatccagaccggt
accgcggcccaggctgatgccgctcgtaagcagctgcgtgaagaactgcaggcgattgcg
ccggtctttactcagaagccttacttcctgagcgacgaattcagcctggtcgattgctac
ctggctccgctgctgtggcgtttgccggttctcggcgtagaactggtgggtgctggcgcg
aaagagcttaagggctatatgactcgcgtcttcgaacgtgattctttcctcgcttcttta
actgaagccgagcgtgaaatgcgcctcggccggggctaa

DBGET integrated database retrieval system