KEGG   Enterobacter asburiae LF7a: Entas_0303Help
Entry
Entas_0303        CDS       T01604                                 

Definition
(GenBank) Glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:eas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Entas_0303
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eas02000]
    Entas_0303
Enzymes [BR:eas01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Entas_0303
Transporters [BR:eas02000]
 Other Transporters
  Pores ion channels [TC:1]
   Entas_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AEN63058
UniProt: G2S0K5
LinkDB All DBs
Position
331264..331935
Genome map
AA seq 223 aa AA seqDB search
MLTVHHLNQSRSQRVIWALEELSLPYQIVHYQREKNMLAPAALRKVHPLGKSPVIEDNGL
ILAESGAILEYLQETYDAEFQLKPRDPAHKVQYRFWLHYAEGSLMPLLLMKLVFASLGKP
PIPFGLRALGKVLGQGVQKAWLNRQLETHARYIESYLSENSWFAGEHFSMADIQMSFPVF
ALLARGGVENLPHIHAWKKRVEMRPGWQRTLEQGGPFDIPGEG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgtacaccatcttaatcagtcgcgttcacagcgtgtgatttgggcgctggaa
gaactttctttgccttatcagatagttcactaccagcgcgaaaagaacatgctggcacct
gcggcgctgcgaaaagtgcatccgctgggtaaatccccggtgattgaagataacggactg
atcctggcggagtcgggtgccattctggaatatctccaggaaacctatgacgcagagttt
cagcttaagccgcgggatccggcgcataaagtgcaataccgtttctggctgcactacgca
gaaggttcgcttatgccgctgctgttgatgaagctggtttttgcaagcctgggaaaacca
cctatcccgtttggactgcgggcactggggaaggtgctggggcaaggggtacaaaaggcc
tggctcaatcgacagctggaaacccacgcgcgctatatcgaatcttatcttagcgaaaac
agctggtttgccggtgagcacttcagcatggctgatattcagatgagttttccggttttt
gcgctgcttgcgcgaggtggcgttgaaaacctgccacatattcatgcctggaagaaaagg
gtggaaatgcgcccaggatggcaacgtactctcgaacaaggcgggccgttcgatattcca
ggcgaaggctga

DBGET integrated database retrieval system