KEGG   Enterobacter soli: Entas_0723Help
Entry
Entas_0723        CDS       T01604                                 

Definition
(GenBank) Spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
eas  Enterobacter soli
Pathway
eas00270  Cysteine and methionine metabolism
eas00330  Arginine and proline metabolism
eas00410  beta-Alanine metabolism
eas00480  Glutathione metabolism
eas01100  Metabolic pathways
Module
eas_M00034  Methionine salvage pathway
eas_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:eas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Entas_0723
   00330 Arginine and proline metabolism
    Entas_0723
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Entas_0723
   00480 Glutathione metabolism
    Entas_0723
Enzymes [BR:eas01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     Entas_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_11 Methyltransf_31 MTS Methyltransf_12 FtsJ MetW
Motif
Other DBs
NCBI-ProteinID: AEN63474
LinkDB All DBs
Position
complement(783014..783883)
Genome map
AA seq 289 aa AA seqDB search
MADNALWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDE
FIYHEMMTHVPLLAHGQAKHVLIIGGGDGAMLREVSRHKSVESITMVEIDAGVVSFCRQY
LPNHNAGSYDDPRFSLVIDDGVNFVNQTTQTFDVIISDCTDPIGPGASLFTSSFYEGCKR
CLKPGGIFVAQNGVCFLQQDEAIDSHRKLSTYFGDVSFYQAAIPTYYGGIMTFAWATDNE
VLRHLSTEIIQARFHQAGLQCRYYNPAVHTAAFALPQYLQDALSSQGVN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaacgcgttgtggcatgaaacactgcatgatcagtttggtcagtactttgcc
gttgataacgtgctttatcatgagaaaaccgatcatcaggatctgatcattttcgaaaac
gctgcttttggccgcgtgatggcgctggacggcgtggtgcaaaccaccgagcgtgacgag
tttatctatcacgagatgatgacccacgtaccgctgctggcacacggacaggcaaaacac
gttctgattatcggcgggggtgatggcgccatgctgcgtgaagtctcccgccataaatct
gtcgaatccatcaccatggtggaaatcgacgcaggcgttgtctctttctgccgccagtat
ctgcccaatcataatgctggcagctatgacgatccgcgctttagtctggtgattgacgat
ggggttaactttgttaaccagaccacacaaacctttgatgtgatcatctctgactgcacc
gacccaatcggcccgggcgcatcgctgtttacctcatccttttacgaaggctgcaaacgt
tgccttaagcccggcgggatcttcgtggcgcagaatggcgtctgcttcctgcaacaggat
gaagccatcgacagccaccgcaagttaagcacctattttggcgatgtcagtttctatcag
gccgcgattccgacttactacggcgggattatgaccttcgcctgggcaacggataacgaa
gtgctgcgccatctctccaccgaaatcattcaggcccgtttccaccaggccggtcttcag
tgccgatattacaatccggcagtccacaccgccgcgtttgccttaccacagtatctgcaa
gacgcgttgtcctctcagggggtgaactaa

DBGET integrated database retrieval system