KEGG   Enterobacter soli: Entas_1120Help
Entry
Entas_1120        CDS       T01604                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Entas_1120
Enzymes [BR:eas01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Entas_1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 NAD_binding_8 Thi4 K_oxygenase AlaDh_PNT_C FMO-like Glutaredoxin DAO
Motif
Other DBs
NCBI-ProteinID: AEN63866
LinkDB All DBs
Position
1217768..1219333
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSAKVTFKEDNSLAV
RKPSFLITNPGSDQGLRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVYMNGQE
FGQGRMTLTEIVAKVDTGAEKRAADELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYEVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIVLNAQTTEVKGD
GSKVTGLEYRDRVSGDVHNVALSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactaatatgaaaacccagctcaaggcctaccttgagaaactgactaaacct
gttgagctgattgccacgctggatgacagcgctaaatcggcggagatcaaggaactgctg
gcagagatcgccgaactgtcagcaaaagtgaccttcaaagaagataacagcctggcagta
cgtaaaccgtctttcctgataactaacccaggttcagaccaggggctgcgctttgccggt
tccccactgggtcacgaatttacctcactggtgctggcactgctgtggaccggtggtcat
ccgtcgaaagaagcgcaggcgctgctggagcagatccgcgatatcgatggtgatttcgaa
tttgaaacctattactcgctctcttgccacaactgcccggacgtagtgcaggcgttgaac
ctgatgtcggtactgaacccgcgtattaagcacacggcgattgacggcggtaccttccag
aatgaaatcaccgatcgcaacgtgatgggtgttccggcggtatatatgaatggtcaggaa
ttcggccagggccgtatgacactgacggaaatcgttgccaaagtggataccggcgcagaa
aaacgtgcggcagacgagctgaacaaacgcgatgcttacgatgtgctgattgtaggttcc
ggcccggcgggtgcagcggcggcggtttactccgcacgtaaaggtattcgcactggtctg
atgggcgaacgctttggcggccaggtgctggataccgtggatatcgaaaactacatctcc
gtaccgaaaaccgaaggccagaaactggcgggcgccctgaaggcacacgtcagcgattac
gaagtggatgtgatcgatagccagagcgctagcaagctggttcccgcggcggttgaaggc
ggcttacaccagattgaaaccgcctccggcgcggtgctgaaagcacgcagtattatcatt
gccaccggcgcaaaatggcgcaacatgaatgtgcctggcgaagatcagtatcgcaccaaa
ggggtgacctactgcccgcactgcgatggcccactgtttaaggggaaacgtgttgcggtc
attggcggcggtaactccggcgtggaagcggcaatcgacctggcgggcattgttgagcat
gtaacgctgctggagtttgcgccagagatgaaagcggaccaggtgcttcaggataaagtg
cgcagcctgaaaaacgtcgacatcgtgctgaatgcgcagaccacagaagtgaagggcgat
ggcagcaaagtgacggggctggaataccgcgaccgcgtaagtggcgatgtgcataacgtg
gcgctttcgggcatttttgtacagattggcctgctgccgaacaccacctggctggaaggg
gcaattgagcgtaaccgcatgggtgaaatcatcatcgacgcaaaatgcgaaaccagcgtg
aagggcgtatttgcggcgggcgactgcaccaccgtaccgtacaaacagattatcatcgcc
accggtgaaggcgcgaaagcctctctgagctcgtttgattatctgatccgtacgaagaca
gcataa

DBGET integrated database retrieval system