KEGG   Enterobacter soli: Entas_1663
Entry
Entas_1663        CDS       T01604                                 

Definition
(GenBank) integral membrane sensor signal transduction histidine kinase
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
eas  Enterobacter soli
Pathway
eas01503  Cationic antimicrobial peptide (CAMP) resistance
eas02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Entas_1663
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Entas_1663
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eas01001]
    Entas_1663
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eas02022]
    Entas_1663
   01504 Antimicrobial resistance genes [BR:eas01504]
    Entas_1663
Enzymes [BR:eas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Entas_1663
Protein kinases [BR:eas01001]
 Histidine kinases
  OmpR family
   Entas_1663
Two-component system [BR:eas02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   Entas_1663
Antimicrobial resistance genes [BR:eas01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    Entas_1663
SSDB
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HAMP HisKA HATPase_c_3 HATPase_c_2 Med10 OmpH
Other DBs
NCBI-ProteinID: AEN64404
LinkDB
Position
complement(1807702..1809165)
AA seq 487 aa
MKGILRHILPLSLRVRFLLATAAVVLVLSLSYGMVALVGYSVSFDKTTFRLLRGESNLFY
TLAKWEDNHISVDMPENLNQQSPTMALIYNEKGKLLWAQRDVPWLVQRIRPEWLKTNGFH
EIEADLNASSTLIRNDLSLQQKLDEIRADDNETEMTHSVAINLYPATTQMPQLTIVVIDT
IPVELKRSYMVWSWFIYVLAANLLLVIPLLWLAAWWSLRPIESLAKEVRELEEHHREKLN
PDTTRELTSLVRNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVMQSTLRSMRSAKLSV
DDAEPVMLEQISRISQQIGYYLHRASMRSGSALLSRELHPVAPLLDNLTSALNKVYQRKG
VNISLDISPEISFVGEKNDFMEVMGNLLDNACKYCLEFVEVSARQTENELHIIVEDDGPG
IPRNKRDVVFDRGQRADTLRPGQGVGLSVALEIVDQYDGKIETGESLLGGARMEVIFGRQ
QPTLNDS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgaaagggatactccgccacattttacccctctcgctgcgggttcgttttctgctggca
accgccgccgttgtgctggtgctctccttgtcttatggcatggttgccctggtcgggtat
agcgtaagttttgataaaaccacgtttcgcctgctgcgcggtgaaagtaatctgttttac
accctggcgaagtgggaagataaccacatcagcgtggacatgccggaaaacctgaatcag
caaagccccaccatggcgctgatttacaacgaaaagggtaagttactgtgggcacagcgt
gatgttccctggcttgtccagcgcatccgccctgagtggctcaaaaccaacggctttcat
gaaatagaagccgatcttaacgcctccagcaccttgatccgtaacgatctctcccttcag
cagaagctcgatgagatccgtgcagatgataacgaaacggagatgacccactccgtcgcc
attaacctgtatcctgcgacaacccaaatgccgcagctgactatcgtggtgatcgacacc
attccggttgaactgaaacgttcctatatggtgtggagctggttcatttacgttctggct
gccaacctgttgctggtcatccccctgctttggctggccgcctggtggagcctgcgccct
atagaatcgctggcgaaagaggtgcgtgaactggaagagcatcaccgtgagaagctcaac
ccggacaccacccgtgaactgacaagcctggtgcgcaaccttaaccgcctgctgaaaagc
gagcgcgagcgctacgataaataccgcaccaccctcactgaccttacacacagcctgaaa
acaccgctcgccgtgatgcaaagcacgttgcgatcaatgcgcagcgcaaagctgagcgtc
gatgacgccgagccggtgatgcttgagcagatcagccgtatttcacagcaaatcggctat
tacctgcatcgtgccagtatgcgttcaggtagcgcattgctaagccgtgaactgcatccg
gttgccccactgctggataacctcacctccgcgctgaataaggtttatcaacgcaaaggg
gtcaatatcagcctcgatatttccccggaaatcagctttgtgggtgagaaaaatgatttt
atggaagtgatggggaacctgctcgacaacgcgtgcaaatattgcctggaatttgttgag
gtgtctgcccgacagacagaaaacgaactgcatattattgttgaggatgacggcccggga
attccacgcaataaacgcgatgtcgtttttgaccgcggacaacgtgccgacacgctgcgc
ccgggacagggcgttggcttatccgtcgcgctggagattgttgatcaatacgatggcaag
attgaaaccggcgaaagcttgctgggtggcgcgcgaatggaagttatttttggtcgtcaa
caacccacattgaacgatagttaa

DBGET integrated database retrieval system