KEGG   Enterobacter soli: Entas_2270
Entry
Entas_2270        CDS       T01604                                 

Definition
(GenBank) Glutathione S-transferase domain-containing protein
  KO
K11208  GST-like protein
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    Entas_2270
SSDB
Motif
Pfam: GST_N_2 GST_N GST_N_3 GST_C_2 GST_C_3 GST_C
Other DBs
NCBI-ProteinID: AEN65003
LinkDB
Position
complement(2452609..2453226)
AA seq 205 aa
MMKLYGVPGWGSAISEVMLTLADIPYQFVNVDGFDAPGPQRSLLETLNPLCQVPTLVLEH
GEVMTETAAIALMVLDRCPDLAPPVGQPERRQFQRLLIWLVANVYPTFTYADYPERWVPD
APEQLRKNCLEYRKSLWLWLEEQLNPAPYTFGEQLTLIDVYLAVMRSWGPRHAWFAANTP
KITAVADAVCALPELHKVLKANEII
NT seq 618 nt   +upstreamnt  +downstreamnt
atgatgaaactctatggcgtacccggctggggctcggcaatcagtgaagtgatgctgacc
ctggccgacattccttatcagttcgtcaatgtggacggttttgatgcacccgggcctcag
cgttctttactcgaaacgcttaacccgttgtgccaggtaccaactctggtgctggagcac
ggggaggtaatgacggaaacagcggccatcgccctgatggtgctcgacagatgtccggat
ctcgcaccgcctgtgggccagcctgaacgccgccagtttcagcgcctgcttatctggctg
gtggccaatgtctatcccaccttcacctacgccgattatcccgaacgctgggttcctgat
gcgccggaacagctcaggaagaactgccttgaataccgaaaatcgctctggctgtggctg
gaagaacagctcaatcctgcgccctatacctttggcgaacagctgacgttgattgatgtt
tatcttgcggtgatgcgctcgtgggggccgcggcacgcgtggtttgccgccaacacgcca
aagatcaccgccgttgcggatgccgtgtgtgcgctgccagaactgcacaaggtgttaaag
gcgaacgaaattatctga

DBGET integrated database retrieval system