KEGG   Enterobacter soli: Entas_2618Help
Entry
Entas_2618        CDS       T01604                                 

Definition
(GenBank) putative metal-binding protein
Organism
eas  Enterobacter soli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2492
Motif
Other DBs
NCBI-ProteinID: AEN65347
LinkDB All DBs
Position
complement(2818668..2818904)
Genome map
AA seq 78 aa AA seqDB search
MSIHGHEVLNMMIESGEQYTEQSLVAAIQARFGAAERFHTCSAEEMTAGELVAFLAARGK
FIPAAEGFSTHESKICRH
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccacggacatgaagtgctcaatatgatgattgagtctggcgagcagtacaca
gagcaaagcctggtagcggctattcaggcgcgttttggcgcagcagaacgttttcatacc
tgttcggcagaagagatgacggcgggtgagttggtggcatttctggcggcgcgcggcaag
tttattccggctgctgaagggttttcaacgcacgaaagtaaaatttgccgtcattaa

DBGET integrated database retrieval system