KEGG   Enterobacter asburiae LF7a: Entas_2651Help
Entry
Entas_2651        CDS       T01604                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00500  Starch and sucrose metabolism
eas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Entas_2651
Enzymes [BR:eas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Entas_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: AEN65379
UniProt: G2SAM3
LinkDB All DBs
Position
2852418..2853905
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPAGGELWREVTALAPNLNEIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVATKYGDKAQLLEAIAALKSNDIAVLLDVVVNHKMGADEKESIHVQRV
NEQDRTQIDDEVISCEAWTRYTFPARAGQYSQFVWDFKCFSGIDHIENPDLDGIFKIVND
YSGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVATQPLFIVAEYWSHEVDKLQNYINQVDGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTDTLVESDPFHAVTLVANHDTQPLQALEAPVESWFKPLAYALILLREN
GVPSVFYPDLFGASYDDVGGDGETYHIDMPVIEQLHELILARQRFAHGIQTLFFDHPNCI
AFSRSGTEEYPGCVVVLSNGDDGEKTLCLGENYGNKTWRDFLGNREETVTTAADGEGIFT
CNGGSVSVWVMEDVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccaccctgttacaatgctttcactggtattaccctgctggcggtgaattg
tggagagaggtcacggcacttgcccccaatctcaacgaaatcggcatcaatatggtctgg
ctccctcccgcgtataaaggcgcatcgggcggctattccgttggatatgactcttacgac
ctgttcgatctcggtgagtttgatcagaaaggcagcgtcgccaccaaatacggtgataag
gcccaacttctggaagccattgccgcgttaaaaagcaacgatatcgccgtgctgctggac
gtggtggtgaatcataaaatgggggcagatgagaaagaatctattcatgtccagcgtgta
aacgagcaggaccgcacgcaaattgacgatgaagtcattagctgcgaagcctggacccgc
tacaccttccccgcccgcgcgggtcagtattcgcaatttgtctgggattttaaatgtttc
agtggcatcgatcatattgaaaatcccgacctggacggcatctttaagatcgttaatgac
tacagcggtgaaggctggaatgaccaggttgatgatgagatggggaattttgattacctg
atgggcgagaacatcgactttcgtaatcatgccgtgaccgaagagataaaatactgggca
cgctgggtcatggagcaaacccagtgcgatggttttcgtctggatgcggtaaaacatatt
ccggcctggttttacaaagagtggattgagcacgttcaggaggttgccacccagcccctc
tttatcgtggcggaatactggtcgcatgaagtggataaattgcagaactacatcaaccag
gttgacggcaaaaccatgctgtttgatgcccccctgcaaatgaaattccacgaagcttcg
cgccaggggcgtgattacgacatgagccagatttttaccgacacgctggttgagagtgac
cctttccacgccgtcaccctggtggcaaaccacgacacccagcccttgcaggcccttgaa
gcaccggtggagtcctggtttaaaccgctggcctacgccctgatattgctgcgtgaaaac
ggcgtaccgagcgtgttttacccggatttattcggcgcaagttatgacgacgtgggcggt
gacggcgagacttatcatatcgacatgccggttatcgaacagcttcacgaacttattctg
gcgcgccagcgttttgcccacggcattcagacgctgttctttgatcatccaaactgtatt
gcgtttagccgtagtgggacggaagaatacccaggctgtgtggtggtgttatctaacggt
gatgacggggagaaaaccctgtgtctgggcgagaactacgggaataaaacctggcgtgac
tttttgggtaatcgcgaagaaaccgtcaccacggcagcagacggtgaagggatcttcacc
tgcaacggcggaagcgtcagcgtgtgggtaatggaggatgttctgtaa

DBGET integrated database retrieval system