KEGG   Enterobacter soli: Entas_3054Help
Entry
Entas_3054        CDS       T01604                                 

Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
eas  Enterobacter soli
Pathway
eas00071  Fatty acid degradation
eas00280  Valine, leucine and isoleucine degradation
eas00281  Geraniol degradation
eas00310  Lysine degradation
eas00362  Benzoate degradation
eas00380  Tryptophan metabolism
eas00410  beta-Alanine metabolism
eas00640  Propanoate metabolism
eas00650  Butanoate metabolism
eas00903  Limonene and pinene degradation
eas00930  Caprolactam degradation
eas01100  Metabolic pathways
eas01110  Biosynthesis of secondary metabolites
eas01120  Microbial metabolism in diverse environments
eas01130  Biosynthesis of antibiotics
eas01200  Carbon metabolism
eas01212  Fatty acid metabolism
Module
eas_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Entas_3054
   00650 Butanoate metabolism
    Entas_3054
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Entas_3054
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Entas_3054
   00310 Lysine degradation
    Entas_3054
   00380 Tryptophan metabolism
    Entas_3054
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Entas_3054
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Entas_3054
   00281 Geraniol degradation
    Entas_3054
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Entas_3054
   00930 Caprolactam degradation
    Entas_3054
Enzymes [BR:eas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Entas_3054
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Entas_3054
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Entas_3054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DUF362
Motif
Other DBs
NCBI-ProteinID: AEN65778
LinkDB All DBs
Position
complement(3277217..3279364)
Genome map
AA seq 715 aa AA seqDB search
MDMTSAFTLNIRPDNVAVVTIDVPGEKMNTLKAEFGVQVRAMLKQIRENKELRGLVFISA
KPDNFIAGADINMIARANNALEAEELARQGQQVMAEIHALPVPVIAAIHGACLGGGLELA
LACHSRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALEMILTGKQLRARQAL
KTGLVDEVVPYSILLEAAVERALKGRQAKPHLPVRERILAGPLGRALLFSMVGKKTAQKT
KGNYPATTRILEVIETGLAHGSSSGYAAEAKAFGELAMTPQSQALRSIFFASTDVKKDPG
SDAEPASLRAVGVLGGGLMGGGIAFVTASKGKLPVRIKDINPKGINHALQYSWQQLDQKV
KRRHIKASERDKVLALISGTTDYSGFAHRDLVIEAVFEDLALKQKMVADVEQYCAPHTIF
ASNTSSLPIGDIAAHAARPEQVIGLHFFSPVEKMPLVEVIPHATTSPQTIATVVKLAKMQ
GKTPVVVADKAGFYVNRILAPYINEAMRLLTEGEKIEHVDESLVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGDRFSPPANIVSVILKDDRKGRKNERGFYLYAQKGRKSKKQVDPS
VYGLISATGQGKLSAVQCAERCVMMMLNEAARCFGEQVIKSARDGDIGAVFGIGFPPFLG
GPFRYMDTLGAGEVVATLQRLATQYGPRFTPCDELLQMAERGQTFWSARETGLVS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggacatgacatcggcatttacgctcaatattcgccccgataacgtcgctgttgtcaca
attgatgtccccggcgaaaagatgaataccctgaaggccgagttcggtgttcaggtgcgg
gcgatgttaaagcagatccgtgaaaataaagagcttcgtgggctggtctttatttcggcc
aagccggataactttattgccggggcggatatcaacatgatcgcccgcgcgaataatgcc
ctggaagcggaagagctggcgcggcagggacagcaggtgatggccgagatccacgcgttg
cctgttccggtgattgcggctattcacggggcgtgtctcggtggtgggctggaacttgcc
ctggcctgtcacagccggatatgtaccgacgatgcgaaaaccgttttaggtttacctgaa
gtgcagcttgggctgttaccggggtcgggtggcacgcagcgtttaccacggctggtcggc
gtgagtacggcgctggagatgattttaaccggcaagcaacttcgtgcgcgtcaggcgctg
aaaacgggtttggtggatgaggttgtaccgtattcgatattactggaagccgctgttgaa
cgggcgctgaaagggcgtcaggccaaacctcatctgccggtacgtgagcgtatcctggcg
ggcccgcttgggcgcgcgctacttttcagtatggtcggtaagaaaacagcgcaaaaaacg
aagggcaactatccggcaaccacacgcattctggaagtgattgaaaccggtctggcgcac
ggcagcagcagtgggtatgccgctgaggcaaaagcctttggtgaactggcgatgacgccg
cagtctcaggcattgcgcagcatcttctttgccagcaccgatgtgaaaaaagatccgggc
agtgacgctgaacctgcatctttgcgcgctgtgggagtgttgggtggtgggctgatgggc
ggtggtatcgcctttgtgaccgccagcaaaggcaaattgcccgtgcgtatcaaagacatc
aacccgaaagggattaatcatgcgctgcaatacagctggcagcagcttgatcaaaaggtc
aaacgccgccatataaaggctagtgagcgagacaaagtgctggcgctgatttcggggacg
acggattacagcgggtttgcccaccgtgaccttgttattgaagcggtatttgaagattta
gcgctcaagcaaaagatggtggcagatgtagagcagtattgcgcaccccataccattttt
gcctctaacacctcgtcgctaccgattggtgatattgcggcgcatgctgctcgccctgaa
caggtgattggcctgcatttctttagtccggtcgaaaaaatgccgctggtagaagtcatt
ccacacgccacgaccagcccgcagaccatcgctaccgtcgtgaagcttgccaaaatgcag
ggcaagacgccggttgtggtggccgataaagccggtttctacgttaaccgtattcttgcg
ccttatataaatgaggcaatgcggctactgacggaaggggagaagatcgaacatgttgac
gagtcgctggtcaagtttggtttcccggttggcccaatccaacttttggatgaggtagga
atagataccggcactaaaattataccagtgctggaagccgcatatggagatcgttttagc
ccgcctgcaaacattgtttccgtaatattgaaggacgatcgcaaaggcagaaaaaatgaa
cgcggtttctatctttacgcgcagaaagggcgtaaaagcaagaaacaggtcgacccttcg
gtttatgggcttatttcggcaaccgggcagggaaaactgtcggcggttcagtgtgctgaa
cgctgtgtgatgatgatgcttaatgaagcagcgcgctgctttggtgagcaggtaatcaaa
agcgcacgtgatggtgatataggtgctgtttttggtatcggtttcccgccgttccttggc
ggcccgttccgttatatggatacactgggagcgggtgaagtggttgccactctgcaacgc
cttgccacgcaatatggtccgcggtttacaccctgtgacgaattattgcaaatggcagaa
cgcggccaaactttttggtctgcaagggaaactggcctcgtaagttga

DBGET integrated database retrieval system