KEGG   Enterobacter asburiae LF7a: Entas_4154Help
Entry
Entas_4154        CDS       T01604                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00250  Alanine, aspartate and glutamate metabolism
eas00410  beta-Alanine metabolism
eas00640  Propanoate metabolism
eas00650  Butanoate metabolism
eas01100  Metabolic pathways
eas01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Entas_4154
   00650 Butanoate metabolism
    Entas_4154
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Entas_4154
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Entas_4154
Enzymes [BR:eas01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Entas_4154
Amino acid related enzymes [BR:eas01007]
 Aminotransferase (transaminase)
  Class III
   Entas_4154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEN66859
UniProt: G2S3G9
LinkDB All DBs
Position
complement(4439193..4440458)
Genome map
AA seq 421 aa AA seqDB search
MKNKELNDRRLQATPRGIGVMCNFYADKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VIAAIEKQLHAFTHTAYQIVPYEGYVALAERINERVPIDGPAKTAFFSTGAEAVENAVKI
ARAYTKRPGVITFGGGFHGRTYMTMALTGKVAPYKIGFGPFPGSIYHAQYPNALHGVSSQ
EALNSVERIFKADIAPDQVAAIILEPVQGEGGFNVAPADFMQSLRALCDTHGILLIADEV
QTGFARTGKLFSMEHHCVKPALITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEEDLCTRAAHLGHHLVEVLNKAKADCPFIADIRAQGSMVAVEFND
PQTGQPSPDFTRQVQERALQEGLLLLSCGVYGNVIRFLYPLTIPEVQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataaagaactgaatgaccggcgtttacaggcaacgccgcgcggtatcggcgtg
atgtgtaacttttatgccgataaagcagagaacgccacgctgtgggatgtggaaggtaac
gaggttatcgacttcgccgccgggatcgccgtgctgaataccgggcatcgccatccgaaa
gtgattgcggccattgaaaaacagctccacgcctttacccacactgcatatcaaattgta
ccgtacgaaggctacgtggcgctggcagaacggattaacgaacgtgtgccgattgacggc
ccggcaaaaacggccttcttctcaacgggcgcagaagccgttgagaacgcggtgaaaatt
gcccgcgcgtacaccaaacgtcctggcgttatcaccttcggtggcggtttccatggccgc
acctatatgaccatggcgttgaccggcaaggtcgcgccttacaaaatcggttttggtccc
ttccctggctcgatttaccacgcacaatatcccaatgcacttcacggcgtgagcagccag
gaagcgttaaacagcgtcgagcgtatcttcaaagcggatattgccccggaccaggttgcc
gccattattcttgagccggtgcagggagagggcggttttaacgtcgcccctgccgatttc
atgcagtcgctgcgggcattatgcgatacccacggtattttgctgatcgccgacgaagtg
caaaccgggtttgcccgtaccggcaaactcttctcgatggaacaccactgcgtgaagcca
gctctgatcaccatggcgaaaagcctggcgggcgggatgccgctctcggcagtgtctggc
cgggcagaggttatggatgcgccagcgccgggcgggctgggcggtacctatgcgggtaac
ccgctggcgatagccgcggcacatgccgtgctggacgtgattgacgaagaagatctctgc
acgcgtgcggcgcatcttggtcatcatctggtggaagtgctcaacaaagcgaaggcggat
tgtccgtttattgccgatatccgggctcagggttcaatggtggcggtggaattcaacgat
ccgcaaaccgggcaaccttcgccggactttacccgtcaggtccaggagcgtgcattgcag
gaaggcctgttactgctgagttgcggtgtgtatggcaacgtcattcgcttcctttacccg
cttaccatccccgaagtgcagttccgtaaagcgctggatattatctctgcctcgctgaca
cgataa

DBGET integrated database retrieval system