KEGG   Enterobacter asburiae LF7a: Entas_4359Help
Entry
Entas_4359        CDS       T01604                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
eas  Enterobacter asburiae LF7a
Brite
Enzymes [BR:eas01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Entas_4359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Spore_YpjB
Motif
Other DBs
NCBI-ProteinID: AEN67064
UniProt: G2S6K6
LinkDB All DBs
Position
complement(4686262..4686882)
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLSAEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIVGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtatgcctacgacgcactggaaccgcatttcgac
aagcagacgatggaaatccatcacactaaacatcaccagacttatgtgaacaacgcgaac
gcagcgctggaaagcctgccagaattcgcaaacctgtctgctgaagagctgatcaccaaa
cttgaccagctgccagctgacaagaaaaccgttctgcgtaacaacgcaggtggtcatgct
aaccacagcctgttctggaaaggcctgaaaaccggcacgaccctgcaaggcgacctgaaa
gcagctatcgagcgcgatttcggctctgtagacaacttcaaagctgagtttgaaaaagct
gctgctacccgtttcggctctggctgggcgtggctggtactgaaaggcgacaaactggct
gttgtctctaccgcaaaccaggactccccgctgatgggtgaagcaatttctggcgcatcc
ggcttcccaatcgtgggcctggacgtgtgggaacacgcttactacctgaaattccagaac
cgtcgccctgactacatcaaagcattctgggatgtggttaactgggacgaagctgcagcg
cgtttcgccgctaaaaaataa

DBGET integrated database retrieval system