KEGG   Exiguobacterium sp. AT1b: EAT1b_0125Help
Entry
EAT1b_0125        CDS       T00897                                 

Definition
(GenBank) peptidase M4 thermolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
eat  Exiguobacterium sp. AT1b
Brite
KEGG Orthology (KO) [BR:eat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eat01002]
    EAT1b_0125
Enzymes [BR:eat01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     EAT1b_0125
Peptidases [BR:eat01002]
 Metallo Peptidases
  Family M4: thermolysin family
   EAT1b_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 PepSY FTP
Motif
Other DBs
NCBI-ProteinID: ACQ69059
UniProt: C4L1B3
LinkDB All DBs
Position
100561..102090
Genome map
AA seq 509 aa AA seqDB search
MKKVVSTSLIAGVLLVPQLVGAAELKSGTLTKPSESAPTTIVKEYVKSKGEFKTIESKSD
KVGKVVKLQQTVDGVPVFGGVVVGVVDEAGQLKTVVDDAKSVKNLHKSIKLTEKKAIASY
KKLVGHKGAYELEPEAELIVYPKGDKSVYAYQVTGTILEAEEPSRWTYFIDAGTGEVLNK
FDQLAHARPTNGVTGTTYTGTGIDVLGYSQTFKTTKSGSYYYLQDSTRGKGIYTYDAKNR
TTLPGSLWADVDNVLNTTYDRAAVSAHVNATKTYDFYKNTYGRNSYDNAGAALNSTVHYS
RSYNNAFWDGSKMVYGDGDGQTFTYLSGALDVVAHELTHAITEYTAGLIYQNESGAINEA
VSDILGTVAEYSVGTNFDWLVGEDIYTPGVAGDGLRSMANPAAYGDPDHYSKRYTGTQDN
GGVHINSGIVNKAAYLLGNGGSHYGVSVQGVGVMAMGDIYYRALNVYLTPTSNFSSLRQA
VVQSAKDLYGATSPQAVSAAKSFDAVGIY
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttgtttctacatcattaatcgcaggcgtcttgctcgtcccacaattggtc
ggtgcggcagaattgaagtcaggcactctgacgaaaccatcagagagtgcgccgacaacg
attgtaaaagagtacgtcaaatcaaaaggtgagttcaagacgatcgagtcgaagtcagac
aaagtcgggaaagtggttaaactccaacagacagttgatggcgtgccagtattcggtggt
gtggtagtcggtgtcgtagatgaagcgggtcaattgaagacagtcgtggatgatgcgaaa
tcggtcaagaacctacataagtcgatcaagttaactgaaaagaaagccatcgcgagttac
aaaaagcttgtcggtcataaaggggcctacgagctcgaaccggaagcagaattgattgtc
tatccaaaaggtgacaagtcggtctatgcatatcaagtgaccggaacgatccttgaagcg
gaagagccatcacgttggacatacttcatcgatgcgggaacgggtgaggtactcaataaa
ttcgaccagttggctcacgcgagaccgacgaacggtgtgacgggtactacctatacggga
acgggaatcgatgtgctcggctacagccaaacgttcaagacaacgaaaagcggatcttac
tattatctccaagattcaacgcgtggaaagggaatctatacgtacgatgcgaaaaaccgt
acgacactcccaggttcgctatgggctgacgtggataacgtcttgaacacgacttacgac
cgtgccgctgtctctgcacacgtcaacgcgacaaagacatatgatttctacaaaaacact
tacggacggaacagctatgacaacgccggagctgcattaaactctacggttcactatagc
cgcagctacaacaatgcgttctgggatggaagtaagatggtatacggagacggagacggt
caaacgttcacgtatctttcaggtgcacttgacgtagtcgctcacgaattgactcacgcg
atcacggagtacacggcaggactgatctatcaaaacgagtctggggcgatcaacgaagca
gtatcggatatcctaggtacagtggcggaatatagcgtcggcactaacttcgactggttg
gtaggggaagacatctacacaccaggtgtagcgggcgacggacttcgttcgatggcgaac
ccggctgcatacggtgacccagatcactactcgaaacgttacacaggcacacaagataat
ggtggggttcacatcaactcaggtatcgtcaacaaagcggcatacctcttaggtaatggt
ggatcacactacggcgtatcggtacaaggtgtaggagtcatggcgatgggggatatctac
taccgtgccctcaacgtttacttgacaccaacatctaacttctcaagccttcgtcaagcg
gtcgtgcaatctgcgaaagacctttacggtgcgacaagtccacaagcggtatcagctgcg
aaatcatttgacgctgtcggaatctactaa

DBGET integrated database retrieval system