KEGG   Exiguobacterium sp. AT1b: EAT1b_0936Help
Entry
EAT1b_0936        CDS       T00897                                 

Definition
(GenBank) ComF operon protein 3
  KO
K02242  competence protein ComFC
Organism
eat  Exiguobacterium sp. AT1b
Brite
KEGG Orthology (KO) [BR:eat00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eat02044]
    EAT1b_0936
Secretion system [BR:eat02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   EAT1b_0936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran PRTase_2 UPRTase zinc-ribbons_6 zf-RING_10 Pribosyl_synth DZR zf-CHY TackOD1
Motif
Other DBs
NCBI-ProteinID: ACQ69865
UniProt: C4L5Q0
LinkDB All DBs
Position
complement(883937..884605)
Genome map
AA seq 222 aa AA seqDB search
MRCLICHESMTVPWTPATLWRRDWVCPSCESKLTPLGTGCPRCGQPNETGETCPDCIRWL
ALGLDLTVRCLYAYDDAGIDWLHRFKFSGDVVIASSVAPALRALRSSGVTYVPVPLSKER
LQTRRFNQAEVLARCIGPTRQLLEKTEVSSQRELGKEGRRHRTNPFTVPTSVKCGKIILV
DDVYTTGTTLHQAAFSLRQAGASEVSAICLFRALNKSKSRPI
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagatgccttatttgtcatgagtcgatgaccgtcccgtggactcctgccacattatgg
cgacgagactgggtgtgtccttcttgcgagtcgaaactgacgccgctcggtacgggttgc
ccgcgctgtggtcaaccgaatgagaccggtgagacgtgtccggactgcatccgctggctc
gcgctcggtctagacttgaccgtccgctgcctgtacgcatacgacgatgcaggaattgac
tggctacatcgatttaaattcagcggggacgtcgtcattgcctcatcggtcgcgccagca
cttcgggcattgcgttcatctggcgtgacctatgttccggtcccgttgagtaaggagcga
cttcagacacgtcgcttcaatcaggccgaggtgctcgcgcgatgtatcggtccgacgcgg
cagcttctcgaaaaaacggaggtttcaagtcaacgtgaactcgggaaagaaggaagacga
caccgaacgaatcctttcactgtaccaacttcagtgaaatgtgggaaaatcattcttgta
gacgacgtctatacgacggggacgacccttcatcaggcggcattttcgttgcgacaggca
ggtgcatcagaagtttctgcgatttgcttatttcgggcgctaaacaaatcgaaatcgcgt
ccgatataa

DBGET integrated database retrieval system