KEGG   Exiguobacterium sp. AT1b: EAT1b_1809Help
Entry
EAT1b_1809        CDS       T00897                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
eat  Exiguobacterium sp. AT1b
Brite
KEGG Orthology (KO) [BR:eat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EAT1b_1809
Enzymes [BR:eat01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EAT1b_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like DAO FAD_oxidored FAD_binding_3 AlaDh_PNT_C NAD_binding_7 K_oxygenase Thi4 NAD_binding_8 Glutaredoxin FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ACQ70735
UniProt: C4L072
LinkDB All DBs
Position
complement(1774177..1775700)
Genome map
AA seq 507 aa AA seqDB search
MLEAAIKQQLDQYLQLMEGDVVLRVSAGEDKVSNEMLELVNELASMSSRISVERATLERT
PSFSVNRPSEETGIVFAGIPLGHEFTSLVLALLQVSGRAPKVDADTIKQIQNIEGTYHFE
SYISLSCHNCPDVVQALNVMSVLNPNITHTMIDGAAFKDEVEAKEIMAVPTVFLNGESFG
NGRMSLEEILAKLGTGPDASAFSDKDPYDVLVVGGGPAGASAAVYAARKGIRTGIIAERF
GGQVMDTMGIENFIGTAYTEGPKLVASLEEHVKEYGIDVMNLQRAKRLEKKDLVEIELEN
GAVLKSKSVILSTGARWRNVNVPGEVEFKNKGVAYCPHCDGPLFEGKRVAVIGGGNSGIE
AAIDLAGIVKHVTVLEFAPELKADQVLQDRLHSLPNVTVITNAQTTEITGTDKVNGISYV
SRETNESHHVELEGVFVQIGLVPNTDWLDSVERNNFGEIVVDRHGATNVPGVFAAGDCTN
SAYKQIIISMGSGATAALGAFDYMIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagcagcgattaaacaacagctcgaccaatatctccagctcatggagggcgat
gtcgtcctccgtgtgagcgctggggaagacaaagtctcaaacgagatgctcgagctcgtc
aacgaactcgccagcatgtcatcacgcatctcggtcgaacgcgcgacactcgagcgtacg
ccgagcttcagcgtgaaccgtccatctgaagagacaggaatcgtcttcgcggggattcca
ctcggacatgagttcacatcactcgtcctcgccctcctccaagtgagcgggcgcgcaccg
aaagtcgatgcggacacaatcaaacaaattcaaaatatcgaaggcacatatcacttcgag
tcatacatcagcctcagctgccacaactgtcctgacgtcgtgcaagcgctaaacgtcatg
agcgtcctcaacccgaacatcacgcacacgatgatcgatggagccgcgttcaaggatgaa
gtggaagcaaaagagatcatggctgtcccgacggtcttcttgaacggcgaatcgttcggt
aacggtcggatgtcactcgaagagatcttggcgaaactcggtacaggtcctgacgcttct
gcgttttcggacaaagacccgtatgacgtcctcgtcgtcggtggcggtccagcgggtgcg
agcgcagccgtatacgcggctcgtaaaggaatccgtaccggaatcatcgcagagcgcttc
ggcggccaagtgatggacacgatggggattgagaacttcatcggtactgcttatacagaa
ggtccaaagctcgtcgccagtctagaagagcacgtcaaagagtacggcatcgatgtcatg
aaccttcaacgcgcgaagcgtcttgagaaaaaggacctcgtcgagatcgaactcgagaac
ggcgctgtcttgaagagtaagagtgtcatcctctcgaccggtgcacgctggcgtaacgtc
aacgtcccaggtgaggtggagttcaaaaacaaaggggtcgcttactgcccgcactgtgac
ggtcctctcttcgaagggaaacgtgtcgcggtcatcggtggcggtaactctgggattgaa
gcagccatcgacctcgcaggaatcgtcaagcacgtaacggtcctcgagttcgctcctgaa
ctcaaggctgaccaagtgctacaagatcgtcttcacagcctcccgaacgtgactgtcatc
acgaacgctcagacgacagaaatcacgggtacggacaaagtgaacggcatctcgtatgtg
tctcgtgagacgaacgagtcacatcatgtcgaattggaaggcgtcttcgtccaaatcggt
ctcgtcccgaacacggactggctcgactcggtcgaacgcaacaacttcggggaaatcgtc
gtcgaccgtcatggcgcgacgaacgtcccaggtgtgttcgcggcaggagactgcacgaac
agcgcctacaaacaaatcatcatctcgatgggttctggtgcgacagccgcactcggcgcc
ttcgactacatgattcgcaactaa

DBGET integrated database retrieval system