KEGG   Exiguobacterium sp. AT1b: EAT1b_2006Help
Entry
EAT1b_2006        CDS       T00897                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
eat  Exiguobacterium sp. AT1b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_24 HTH_34 TrmB HxlR B-block_TFIIIC HTH_20 Penicillinase_R PadR
Motif
Other DBs
NCBI-ProteinID: ACQ70930
UniProt: C4L0W7
LinkDB All DBs
Position
1959082..1959513
Genome map
AA seq 143 aa AA seqDB search
MIESLELKAWVVLARTMDAISDRVKEDLRRHQLNSTEFGVLSVLYKRGDTPLQQIGDQIL
ITSGSVTYVIDKLEKRGLIERIACPSDRRVTYASLTDDGKALMDVVYPQHIEIFKDIYGP
LSDEETEQLISLLKQVGYNAAGK
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatcccttgaattgaaggcgtgggtcgttcttgcgcgtacgatggatgccatc
agtgatcgtgtgaaggaagatttacgacgccaccagttaaattcaacagagttcggtgtt
ttatccgtactgtataaacgaggagacaccccgttacaacaaatcggggaccaaattttg
attacgagcggtagcgtgacatacgtgatcgataagttggagaagcgaggtctgattgaa
cgaatcgcctgtccgtctgaccgacgtgtcacgtatgcatcgttgacggacgatggaaag
gcgctcatggacgtcgtctatccgcaacatattgaaatcttcaaagatatatatggaccg
ttaagtgatgaagagacggaacaattgatttcgttattgaaacaagtcggttataacgca
gcgggcaaataa

DBGET integrated database retrieval system