KEGG   Exiguobacterium sp. AT1b: EAT1b_2266Help
Entry
EAT1b_2266        CDS       T00897                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00473  D-Alanine metabolism
eat01100  Metabolic pathways
eat01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EAT1b_2266
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    EAT1b_2266
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eat01011]
    EAT1b_2266
Enzymes [BR:eat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     EAT1b_2266
Peptidoglycan biosynthesis and degradation proteins [BR:eat01011]
 Precursor biosynthesis
  Racemase
   EAT1b_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACQ71188
UniProt: C4L2D6
LinkDB All DBs
Position
2219764..2220852
Genome map
AA seq 362 aa AA seqDB search
MGVTIDLNAIRENKRRIEALGRPVFAVVKNNAYNLGMEPVVTTLYDEGVRHFMVTTLEEA
LEVRTHAESARVLIMNPVYTWEHVHAHDFDVAIGSYEWLVSQREHLDGVRLHLKLDVGMN
RFGAKTFEEALRIVAFCQNEGLNLVGLCTHFPLADADNAEVEHSVQVERFADWSTRLMER
HTFELIHAANSAATLQDDSRLHHCTHVRVGIFLYGYSSVEPVEWLVPAFYWETEVVAVHD
IEAGAHVGYGTGYTAESKERIAVLPVGYGDGLMRARRHLPVHIEGRAYPFVSNIFMSHSF
IKVDEDVQIGDRVALYGIETKIDDVTRVGYANNSEQLCARSWRVPHRFEGGIVCTPPINQ
NV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggagtcacaattgacttaaatgcgattcgcgaaaacaaacgccggattgaagcgctc
gggcgccccgtgtttgcggtcgtgaaaaacaatgcctataacctaggaatggagccagtt
gtgacgactttgtatgatgaaggggtccgtcacttcatggtgaccacgttagaagaagcg
ctcgaagtgcgaacgcatgcagagtcggctcgcgtcctcatcatgaatccggtatacacg
tgggaacacgtgcatgcccatgattttgacgtcgcaatcggctcgtatgaatggctcgtc
tcgcagcgggagcatctcgatggcgttcgccttcatttgaaactagacgtcggcatgaac
cgattcggtgccaaaacgtttgaagaagcgttacggatcgtcgccttctgccaaaatgaa
ggattgaaccttgtcggattatgtacacattttccgcttgcggatgcagataatgccgaa
gttgagcatagcgtccaagtcgaacgttttgctgactggtcgacacgtttgatggaacgt
catacgtttgaattgattcatgccgcgaacagtgcggccacgctccaagacgactcgcgc
ttgcaccattgcacacatgtgcgtgtcggtattttcttatacggttattcatcggtcgag
ccggttgagtggctcgtacctgcgttttactgggaaaccgaagtggttgccgtccacgac
atcgaagcgggggctcatgtcgggtatggaacgggatataccgcagaatcaaaagaacgg
attgctgtcttacctgtcggatatggggacggattgatgcgagcgagacgtcatttaccc
gttcacatcgaggggagagcttatccgttcgtcagcaatatctttatgagccatagcttc
atcaaagtcgacgaagacgtacaaatcggcgaccgcgtcgcattatatgggatcgaaacg
aaaatcgatgacgtgacacgtgttggctatgccaacaactccgaacagctctgtgcccgt
tcgtggcgtgtcccacatcgctttgaaggaggaattgtatgtacaccaccaatcaatcag
aatgtttga

DBGET integrated database retrieval system