KEGG   Exiguobacterium sp. AT1b: EAT1b_2950Help
Entry
EAT1b_2950        CDS       T00897                                 

Definition
(GenBank) prolyl-tRNA synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:eat00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EAT1b_2950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eat01007]
    EAT1b_2950
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eat03016]
    EAT1b_2950
Enzymes [BR:eat01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     EAT1b_2950
Amino acid related enzymes [BR:eat01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   EAT1b_2950
Transfer RNA biogenesis [BR:eat03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EAT1b_2950
 Prokaryotic type
    EAT1b_2950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b tRNA_edit HGTP_anticodon RRM_9
Motif
Other DBs
NCBI-ProteinID: ACQ71864
UniProt: C4L658
LinkDB All DBs
Position
2907419..2909128
Genome map
AA seq 569 aa AA seqDB search
MNCMKQSRLLMPTLREVPADAEAVSHQLLVRGGFIRQNAAGIYSYLPLGHKVLHNIQTII
REEMNRAGAQELLMPAIQPAELWEETGRWGIYGPELMRLTDRHDRRFALGATHEELITSI
VRDELNSYKKLPMNLYQIQTKYRDERRPRFGLLRGREFLMKDAYSFHATQEDLDEEYTNM
YNAYSRIFDRTGLKYRPVVADSGAIGGKDTHEFQALADIGEDTIVYTDTSNYAANIEMAE
TLDRYEMQQADVRPLEKVDTEENRTIEDVAAFLNVDPKTTIKSVLFNVDGETVMAIVRGD
HEANEVKVKNALGGLDIQLEEEAKIVELFNCAPGTLGPINAPVKVVADYAVKYLVDAVCG
ANEANTHYTGVNAARDLAEMTYHDLRFVVEGDLAPDESGPVRFARGIEVGQVFKLGTRYS
EAMGATFLNEEGRAEPLIMGCYGIGVSRTLSAIVEQHHDDRGIVWPRNVAPFDLHLIAIN
AKDETQVELANRLYEELGQTYDVLFDDRKERAGVKFADADLIGLPIRVNVGKKAGEGIVE
VKVRATGEVIETSIDELKEVIASKFSEVH
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
ttgaactgtatgaaacaatctagattgctcatgcctacattgagagaagttccggctgac
gcggaagcggtcagccatcaactcctcgtccgtggaggattcatccgtcaaaatgcggca
ggaatttattcttatcttccactcggacataaggtgttacacaacatccaaacaatcatc
cgtgaagagatgaatcgtgccggtgcacaagagttattgatgcctgccattcaaccggca
gaactttgggaagagacaggacgttggggcatttacggtcctgagttgatgcgcttgacg
gaccgtcatgaccgtcgtttcgcactcggtgcgacacacgaagaattgatcacatcgatc
gtccgagacgagctcaactcgtataaaaaacttccgatgaacttgtaccagattcaaacg
aagtatcgtgatgagcgtcgtccacgtttcgggttgctccgcggacgtgagttcttgatg
aaagacgcctactcattccacgcgacacaagaagacttagatgaagaatatacaaacatg
tataatgcgtactcacgcatcttcgaccgcacaggactgaagtatcgtccggtcgtcgcg
gactctggggcaatcggcgggaaagatacgcatgaattccaagcgcttgcggatatcggg
gaagacacgattgtctacacggacacgtcgaactatgcggcgaacatcgagatggccgaa
acgctcgaccgttatgagatgcagcaagctgacgttcgtccactcgaaaaagtggacacg
gaagagaatcgtacgattgaagatgtggcagcattcttgaacgtggatccgaaaacgaca
atcaaatctgtcttgttcaacgtggatggcgaaaccgtcatggcaatcgttcgtggcgac
cacgaagcgaacgaagtcaaagtgaagaacgcactcggtggactcgacattcaacttgaa
gaagaagcgaaaatcgttgagttgttcaactgtgcgccaggtacactcggaccgattaac
gctccggtcaaagtcgttgccgactatgcggtcaagtacttagtggatgcagtctgtggt
gccaacgaggcgaacacacactacacgggtgtaaacgctgcgcgcgaccttgccgaaatg
acataccacgatttacgtttcgttgtcgaaggcgatttggcaccggatgagtccggtccg
gttcgttttgctcgtgggattgaagtggggcaagtatttaaactcggaacacgatattca
gaagcgatgggtgcgacgttcctcaacgaagagggtcgtgccgaaccactcatcatgggt
tgctacggcatcggagtgtcacgcacactttcagccatcgtcgaacaacatcacgacgac
cgtggaatcgtttggccacgtaacgtggcgccgttcgatctccatttgatcgcaatcaat
gcaaaagatgagacgcaagtcgagttggcgaaccgtctttatgaagagcttggtcaaaca
tacgatgtcttgttcgacgaccgaaaagaacgcgcgggcgtcaagtttgcagatgcagat
ttgattggacttccgattcgcgtgaacgtcgggaaaaaagccggcgaaggcatcgttgaa
gtgaaagtacgtgcaacaggtgaagtgattgaaacatcaatcgatgaattgaaagaagtc
atcgcttcaaaatttagcgaagttcattaa

DBGET integrated database retrieval system