KEGG   Exiguobacterium sp. AT1b: EAT1b_2979Help
Entry
EAT1b_2979        CDS       T00897                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00473  D-Alanine metabolism
eat00550  Peptidoglycan biosynthesis
eat01100  Metabolic pathways
eat01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EAT1b_2979
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EAT1b_2979
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EAT1b_2979
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eat01011]
    EAT1b_2979
Enzymes [BR:eat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EAT1b_2979
Peptidoglycan biosynthesis and degradation proteins [BR:eat01011]
 Precursor biosynthesis
  Amino acid ligase
   EAT1b_2979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATP-grasp RimK GARS_A TrkA_N ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACQ71893
UniProt: C4L6L4
LinkDB All DBs
Position
2942697..2943623
Genome map
AA seq 308 aa AA seqDB search
MKVAVLYGGVSGEREVSLTSGQGMIEALTERGHEVTAIDFHPERANELLTLDVDVVVSAL
HGKYGEDGRVQSLLEMAGIPYTGSGVLASALAMDKARAKIIFAASGIRVARDVLIESRES
IDAKVAEWGMEFPCVVKPAQEGSSNGLTIAMDEAMLREGIEKAFACDSAVLVEQYIKGKE
LTVPVIGNFGKEEALPVIEIIPKNEFYDYESKYTEGGSIHVCPAEISDDLTSEVQQAAVL
AHRALGCSGYSRSDFLVSEEGKAYILETNTLPGMTPLSLFPDSAKTVGISYGELLERFIE
LALERVAK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgctgttttatatggtggagtgtcaggagaacgagaggtatccctcacgagc
gggcaaggaatgatagaagcgttgacggaacgtggtcatgaggtcacggccattgacttt
catccggaacgtgcgaacgagttattaacgctggacgtcgacgtcgtcgtcagtgcgttg
cacgggaagtatggtgaagatggtcgtgtgcaatcgttattagaaatggctgggattcct
tacacgggatcaggtgtcttggcatctgcactggcgatggacaaggcgagagcgaagatc
atcttcgcggcatccgggatccgcgtcgcgcgtgacgtcttaatcgagtcacgggaatcg
atcgatgcaaaagtcgctgagtggggaatggaattcccatgtgtcgtcaaaccagcgcag
gaaggatcgtcgaacggtctgacgattgccatggacgaagcgatgttacgtgaaggaatt
gaaaaggcgtttgcgtgtgattcagcggtacttgttgaacagtacatcaaagggaaagag
ctgacagttcccgtcatcgggaacttcgggaaagaagaggctcttcctgtcattgaaatc
attccaaaaaatgaattttacgactatgaatcgaagtatacggaaggtggttcgattcat
gtctgtccggctgaaatctcggacgatttgacatcagaggttcaacaggcggcagtcctg
gcacatcgcgcgctcggttgttcaggatattcgcgctctgacttcctcgtttcagaagaa
ggcaaagcctacattctagagacgaatacgctaccgggcatgacgccgcttagcctgttt
ccggatagtgccaagacagtcggaatctcgtacggtgagctattggaacgctttatcgag
ctcgcacttgagcgcgtagcgaagtaa

DBGET integrated database retrieval system