KEGG   Enterobacter asburiae L1: DI57_03865Help
Entry
DI57_03865        CDS       T03084                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eau  Enterobacter asburiae L1
Pathway
eau00564  Glycerophospholipid metabolism
eau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DI57_03865
Enzymes [BR:eau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DI57_03865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 Thi4 DAO_C 3HCDH_N HI0933_like Pyr_redox Pyr_redox_3 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AHW93521
LinkDB All DBs
Position
complement(792194..793822)
Genome map
AA seq 542 aa AA seqDB search
MTIHDPRYSDVIIIGGGATGAGIARDCALRGLSVTLLERHDIATGATGRNHGLLHSGARY
AVTDGESARECIAENQILKRIARHCIEPTDGLFITLPEDDLAFQDTFITACTAAGIQAEA
MDPALARRLEPSVNPALIGAVKVPDGTVDPFRLTAANMLDAREHGARILTGHEVTGLIRE
GNRICGVRILDTQYNEHSELYAAVVVNAAGIWGQRIAEYADLSVRMFPAKGSLLILDHRI
NNHVINRCRKPSDADILVPGDTISLIGTTSTHVDYSEIDYNRVTAEEVDVLLREGEKLAP
VMAQTRILRAYAGVRPLVASDNDPSGRNVSRGIVLLDHAERDGMDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTETCVTADQSLPGSRQSTEKTLQKIISLPAPLRGSAIYRHGDRTP
QWLGEGRLSRSLVCECEAVTAGEVQYAVESLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFHTTTATQSLDQLSAFLNERWKGIQPVAWGDALRESEFTRWVYQGLCGLEKEQRD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcacgatcctcgctacagcgatgtgataatcattggcggtggcgcaaccggc
gccgggatcgcacgcgactgcgcccttcgcggcttaagcgtcacgctgctggagcgccac
gacatcgccacgggcgcaaccgggcgtaaccacggcctgctgcacagtggcgcgcggtac
gcggttaccgacggtgaatccgcgcgcgaatgtattgctgaaaaccagatcctcaagcgt
atcgcccgccactgcattgagccgaccgacggcctctttattacccttcccgaagatgac
ctcgcctttcaggacacctttattaccgcctgcactgcggcgggcattcaggcggaggca
atggacccggcgctggcgcggcggctggaaccgtctgttaacccggcgcttatcggcgcg
gtgaaagtgcctgacggcaccgttgaccccttccgcctgaccgccgccaatatgctggac
gcccgcgagcatggcgcgcgcatcctgaccgggcacgaagtgaccgggcttatccgcgag
gggaatcgcatctgcggcgtgcggatcctcgatacgcaatataacgaacacagcgagctg
tatgccgccgtggtggtcaacgcggcggggatctgggggcagcgcatcgcggaatacgcg
gatctgtcggtgcgcatgttcccggcgaaaggctcgctgctgatcctcgaccaccgcatc
aataaccacgtgatcaaccgctgccgcaaaccgtccgacgccgatatcctcgtcccgggc
gacaccatttcgttaatcggtaccacctcaacccacgtggactacagcgagattgactac
aaccgcgtgaccgccgaagaggtcgacgtcctgctgcgtgaaggggaaaagctggcccct
gtgatggcccagacgcgtattctgcgcgcctacgcgggcgtgcgtcctctggtcgccagc
gacaacgacccgagcgggcgtaacgtcagccggggcatcgtgctgctcgatcacgccgag
cgcgacggcatggacgggtttatcaccatcaccggcggcaagctgatgacctaccgcctg
atggccgagtgggcgaccgatgccgtctgccgcaagctggggaataccgaaacatgcgtg
acggcagaccagtcgctgcccggctcgcggcagtccaccgaaaaaacgctgcaaaaaatt
atctccctgcccgcgccgctgcgcggatccgcgatttaccgccacggcgacagaacgcca
cagtggctcggtgaaggacgactaagccgcagcctggtgtgcgagtgcgaagccgtcacc
gccggtgaggtgcagtacgcggtggagagcctgacggtcaacagcctgctcgatcttcgc
cgccgcacccgcgttggaatgggcacctgtcagggcgagctgtgcgcctgtcgtgccgcc
ggattattgcagcgttttcacaccaccaccgccacccagtcgctcgatcagctcagcgcg
tttttaaacgagcgctggaaaggcattcagcctgtcgcctggggcgatgccctgcgcgaa
agcgaatttacccgctgggtctaccaggggctttgcggtcttgagaaggagcaacgcgat
gaaatttga

DBGET integrated database retrieval system