KEGG   Enterobacter asburiae L1: DI57_08715Help
Entry
DI57_08715        CDS       T03084                                 

Definition
(GenBank) oxidoreductase
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
eau  Enterobacter asburiae L1
Pathway
eau00040  Pentose and glucuronate interconversions
eau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DI57_08715
Enzymes [BR:eau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     DI57_08715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N Shikimate_DH NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AHW94456
LinkDB All DBs
Position
complement(1851478..1852497)
Genome map
AA seq 339 aa AA seqDB search
MKSVVIQQPNELVIEERPRPAPGAGEIRVKITLAGICGSDSHIYRGHNPFAKYPRTIGHE
FFGVIDAVGEGVDSARLGQRVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEY
AAVPAKNAWPIPDDIPDRHAVMVEPFTIAANVTGQANPTEQDVALIYGAGPMGLVTVQAL
KGVYKVKQIIVVDRIDERLKMAQRSGADWVLNNGEQSLQAALDEKGIKPTLIIDAACHPT
ILQEAITLASPAARIVLMGFSSEPSQIVQQGITGKELAIFSSRLNANKFPVVIDWLKKGL
IDPEKLITHTFDYHHVTDAIELFEKDQRQCCKVLLTFGQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgtagtgattcaacagccgaacgaactggtgattgaagagcggccacgcccg
gcgccaggtgcaggcgaaattcgcgtcaaaatcacgctggcggggatctgcggttcggac
agccacatctatcgcggccataatccgtttgcgaagtatccacgtaccatcggccacgag
ttctttggcgtgattgacgccgtgggcgagggcgtagacagcgcccgtctgggccagcgc
gtctcggtcgatccggtgatcagctgcggacactgctacccgtgttccgtcggaaagccg
aacgtctgcacctcgctggtggtgctgggcgtgcaccgcgacgggggcttcagcgaatac
gcggcggtacccgcaaaaaatgcctggcctatcccggatgacattcctgatagacacgcc
gtcatggtggagccttttaccatcgccgccaacgtgacggggcaggccaaccctaccgag
caggacgttgcgctgatttacggcgctggtccgatggggctagtcaccgtgcaggcgctg
aagggcgtctataaggtgaagcagattatcgtggttgaccgcatcgatgaacgcctgaaa
atggcccagcgcagcggcgcggactgggtgttgaataacggcgagcagtcgctgcaggcc
gcgctggacgaaaagggcatcaaaccgacgttaatcattgatgccgcctgtcatccgacg
attttgcaggaagcgataaccctggcctctccggcggcgcgcatcgtgctgatggggttc
tccagcgagccgagccagattgttcagcagggcatcaccggcaaagagctggcgatcttc
tcctcgcgcctcaatgccaataaattcccggtcgtcatcgactggctgaagaaggggctg
atcgaccctgaaaaactgatcacccatacctttgactatcaccatgtaacagacgccatt
gaactgtttgagaaagaccagcggcagtgctgcaaagtcttgctcacgttcggccaataa

DBGET integrated database retrieval system