KEGG   Enterobacter asburiae L1: DI57_18965Help
Entry
DI57_18965        CDS       T03084                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eau  Enterobacter asburiae L1
Pathway
eau00010  Glycolysis / Gluconeogenesis
eau00030  Pentose phosphate pathway
eau00051  Fructose and mannose metabolism
eau00052  Galactose metabolism
eau00680  Methane metabolism
eau01100  Metabolic pathways
eau01110  Biosynthesis of secondary metabolites
eau01120  Microbial metabolism in diverse environments
eau01130  Biosynthesis of antibiotics
eau01200  Carbon metabolism
eau01230  Biosynthesis of amino acids
eau03018  RNA degradation
Module
eau_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DI57_18965
   00030 Pentose phosphate pathway
    DI57_18965
   00051 Fructose and mannose metabolism
    DI57_18965
   00052 Galactose metabolism
    DI57_18965
  09102 Energy metabolism
   00680 Methane metabolism
    DI57_18965
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    DI57_18965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eau01009]
    DI57_18965
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:eau03019]
    DI57_18965
Enzymes [BR:eau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DI57_18965
Protein phosphatases and associated proteins [BR:eau01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DI57_18965
Messenger RNA biogenesis [BR:eau03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DI57_18965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AHW96419
LinkDB All DBs
Position
4009153..4010115
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGVYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDEHVREVAIENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVVPEVEFSREDLVAEIKAGIAKGKKHAIVAITEHICDVDELAKYIEAETK
RETRATVLGHIQRGGSPGPYDRILASRMGAYAIDLLLQGHGGRCVGIQNEKLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
attcgtggtgttgtccgtgcagcgctgacggaaggcctggaagtttttggcgtttatgac
ggttatctgggcctgtatgaagatcgtatggttcagctcgaccgttacagcgtgtctgac
atgatcaaccgtggcggtactttcctcggttccgcgcgcttcccggaattccgtgatgaa
cacgttcgtgaagtggctatcgaaaacatgaagaaacgcggcctggacgccctggtggtt
atcggtggtgacggctcctacatgggtgcaaaacgtctgaccgaaatgggcttcccgtgc
atcggtctgccgggcaccatcgacaacgacatcaaaggtactgactacactatcggcttc
tttactgcactgggaaccgttgttgaagcgattgaccgtctgcgtgacacctcgtcttct
caccagcgtatctctattgttgaagtaatgggccgttactgcggcgacctgacgctggcg
gcagccattgcgggcggttgcgaatttatcgtcgtgccagaagtcgaatttagccgtgaa
gatctggtggctgaaatcaaagcgggcatcgcgaagggtaaaaaacacgcgatcgtggct
attaccgagcacatctgcgacgttgacgagctggcgaagtacatcgaagccgaaaccaaa
cgcgaaacccgcgcgaccgtactgggccacatccagcgcggcggctccccaggcccttac
gaccgtattctggcgtcccgtatgggcgcgtacgctatcgatctgctgctgcagggtcac
ggcggccgctgcgtcggtattcagaacgaaaaactggttcaccatgacatcatcgacgcg
attgaaaacatgaagcgtccgttcaaaggtgactggctggactgcgcgaaaaaactgtac
tga

DBGET integrated database retrieval system