KEGG   Enterococcus avium: EH197_00730Help
Entry
EH197_00730       CDS       T05982                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K19648  D-arabitol-phosphate dehydrogenase [EC:1.1.1.301]
Organism
eav  Enterococcus avium
Brite
KEGG Orthology (KO) [BR:eav00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EH197_00730
Enzymes [BR:eav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.301  D-arabitol-phosphate dehydrogenase
     EH197_00730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2 DUF364
Motif
Other DBs
NCBI-ProteinID: QCQ10773
UniProt: A0A4V1ENH5
LinkDB All DBs
Position
46438..47496
Genome map
AA seq 352 aa AA seqDB search
MSKTMKGVSKQAPGYDQMAFIDLSVPEATDDKVLIKVAYTGICGSDIHTFKGEYKNPTTP
VVLGHEFSGQVVAVGDNVTKVKVGDRVTSETTFYVCGECDYCKEKQYNLCPHRKGIGTQQ
NGSMANYVLAREESIHLLPDHLSYEGAAMSEPLACCVHAMYQKSHLELKDTIIIMGPGPI
GLYLLQIAKEIGAFVIMTGITKDAHRLALAKKLGADVIVDTMKEDIAKVVNEITDGYGVD
KVYDASGAVPAVNASLPLIRKQGQFIQVGLFANKMVDLDTESIIQREIEYIGSRSQNPYD
WPIAIHLLAKGAINIDEMITKKYPLTEWREAFDKVMEGNEIKVMIESNPEEF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacaatgaagggtgtttccaagcaggcacccggttatgaccaaatggcattt
atcgatttatctgttccagaagcaacagatgacaaggtcttgattaaagtcgcttataca
ggtatttgcggatcagatatccatacgtttaaaggtgaatacaaaaatcccactactccc
gtcgtcctaggacatgaattttctggacaagtcgttgcagtaggagacaacgtaacaaag
gtcaaagttggtgatcgggtaaccagtgagacgaccttttatgtctgcggcgaatgcgat
tattgcaaagaaaagcagtataatttgtgtccccatcgaaaaggaatcggcacgcagcaa
aatggctccatggcgaactatgtgttggctcgagaagaaagcattcatttactgccggat
catttaagctatgaaggtgcggcgatgagcgaaccattagcgtgctgtgtccatgcgatg
tatcaaaagagtcacttggaattaaaagacacgatcattatcatgggccccggaccaatc
ggactgtatcttttgcagattgccaaggaaattggagccttcgtcattatgacggggatc
acaaaagatgctcatcgcttagcattagcaaaaaaactaggtgcggatgtgatcgttgat
acgatgaaggaagatatagcgaaagtcgttaatgagatcacggatggctatggtgtggat
aaggtgtatgatgcctcaggagcagttcctgctgttaatgctagtctgccattgattcgc
aagcaggggcaatttattcaagtaggcttgttcgctaataaaatggtggatttagacact
gaatcgatcattcaacgagagatcgaatacatcggcagtcgttcacagaacccttatgac
tggccgattgcgattcacttattagcgaaaggtgcgatcaatatcgatgagatgattacg
aaaaaatatccattgactgaatggcgggaagcctttgataaagtgatggaaggtaatgaa
atcaaggtaatgatcgaatccaatccagaagagttttaa

DBGET integrated database retrieval system