KEGG   Enterococcus avium: EH197_08115Help
Entry
EH197_08115       CDS       T05982                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eav  Enterococcus avium
Pathway
eav00473  D-Alanine metabolism
eav00550  Peptidoglycan biosynthesis
eav01100  Metabolic pathways
eav01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EH197_08115
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EH197_08115
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EH197_08115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eav01011]
    EH197_08115
Enzymes [BR:eav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EH197_08115
Peptidoglycan biosynthesis and degradation proteins [BR:eav01011]
 Precursor biosynthesis
  Amino acid ligase
   EH197_08115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: QCQ12154
UniProt: A0A2N8PZG8
LinkDB All DBs
Position
1537335..1538399
Genome map
AA seq 354 aa AA seqDB search
MKIILLYGGKSPEHDVAILSAFSVISAVYFDYYQVQLIYIDKTGQWVKGPLLTEAPETDE
TLRLTWDPTGNEVEGFSGKVIAPGDIKEDNAIVFPVLHGPNGEDGTIQGFLETLDMPYVG
AGVMTSACAMDKIMTKYILQAAGIPQVPYVPVLKNQWKENPKQIFDKCEGTLLYPMFVKP
ANMGSSVGISRAENREELQNALQEAYRYDSRALVEQGIDAREIEVAVLGNDDVRTTLPGE
VVKEEAFYDYNAKYINNTIQMAIPADVPEDVMQKARDFAKSAYTMLGGSGLSRCDFFLTN
KNELFLNELNTMPGFTEFSMYPLLWENMGLKYSDLIEELIQLGNKRYEQQARFE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataattttactttatggtggaaagagtccagaacacgatgttgcgattttatcg
gctttttcagttatttctgcggtttattttgattattatcaagtacagcttatttatatt
gataaaacaggccagtgggtcaaaggccccttgttgacagaagcgccagaaacagatgaa
acgttacgtttgacgtgggatccgactggaaatgaagttgaaggtttcagcggcaaagta
atcgctcctggcgatatcaaagaagataatgcgattgtttttccagtcttgcacggacct
aatggtgaagatggcacgattcaagggttcttagagacattggatatgccttacgttggt
gcgggtgtaatgacgagtgcttgtgcaatggacaaaattatgacgaaatacattttgcag
gcagctggcatcccgcaggttccttacgttccagtcctaaaaaaccaatggaaagaaaat
cctaaacaaatttttgataaatgtgagggaacgttactgtatccaatgtttgtcaaaccg
gcgaatatgggctctagcgtaggaatttcacgtgctgaaaatcgcgaagaactgcaaaac
gcattgcaagaagcttatcgctatgattcaagagctttagttgagcaaggcatcgatgct
cgtgagattgaagttgcggttttaggcaatgacgatgtgcggacgacattacctggtgag
gtcgtaaaggaagaagcattctatgattacaatgctaaatacatcaataatacgattcaa
atggcaattccagcggatgtgccggaagatgtgatgcaaaaagctcgcgattttgcaaaa
tcagcctatacaatgttaggtggatcaggattaagtcgctgcgactttttcttgacaaat
aaaaatgaattattcttgaatgagctgaatacgatgcccggatttactgagttcagtatg
tatccattgttatgggaaaatatgggcttgaagtatagcgatctgattgaagaattgatt
caattaggaaataagcgctacgaacaacaggcgcgttttgaataa

DBGET integrated database retrieval system