KEGG   Enterococcus avium: EH197_20010
Entry
EH197_20010       CDS       T05982                                 

Definition
(GenBank) PTS mannose/fructose/sorbose transporter subunit IIC
  KO
K11196  fructose PTS system EIIC component
Organism
eav  Enterococcus avium
Pathway
eav00051  Fructose and mannose metabolism
eav02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EH197_20010
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    EH197_20010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eav02000]
    EH197_20010
Transporters [BR:eav02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    EH197_20010
SSDB
Motif
Pfam: EII-Sor DUF4133
Other DBs
NCBI-ProteinID: QCQ14316
UniProt: A0A437ULI6
LinkDB
Position
complement(3934241..3935035)
AA seq 264 aa
MNGLQIILLLIVAGICGMGSVLDEAQTHRPLVACTLVGLVLGDITTGIILGGTLEMMALG
WMNVGLAMAPDTAIASVISTILVITANQGIGEGIAIAVPLAAAGQALTIFVRTITVFFVH
KADNYAAEGNFRGIEAMHLLALAMQALRVMIPTLIISMISAQAVSNFLNSIPEVITGGLQ
IGGGIIVVVGYAMVINMMDVPNLKPFFYIGFLFAAFTNFNLVGFGGLGLCFALLFIQLKY
NNSNKTVVATEQAAMTYDDDDLDA
NT seq 795 nt   +upstreamnt  +downstreamnt
atgaatggattacaaataattctgctcttaatcgtagcgggaatctgtgggatgggaagc
gttcttgacgaagcgcaaacacatcgtccattagtggcatgtacgttggtaggacttgtt
ttgggagatataactactggtattattcttggtggtacattggaaatgatggcgttaggt
tggatgaatgtaggacttgctatggcgccggatacagcgatcgcatcagttatctctact
atcttagttatcacagctaatcagggaattggagaaggaatcgcaatagctgtaccatta
gcagctgctggtcaagcactgaccatttttgtacggacaatcacagttttttttgtccat
aaggcagataattatgcagcggaaggtaattttcgtggaatagaagcgatgcatttgtta
gctctagccatgcaggcccttcgagtaatgattccgacgttgattatttctatgattagc
gcacaagcagtaagcaacttcttaaatagtattccagaggtgattactggaggtttacaa
atcggtggaggcatcattgtggtggttggttatgctatggtgatcaatatgatggatgtt
ccaaatctaaaaccattcttctacattggtttcttattcgctgcctttacaaatttcaat
cttgttggatttggtggtctaggattatgcttcgctctattatttattcagttgaaatac
aacaacagcaataaaacagtagttgcgacagagcaagcagctatgacctacgatgatgac
gatttagatgcatga

DBGET integrated database retrieval system