KEGG   Enterococcus avium: EH197_20020
Entry
EH197_20020       CDS       T05982                                 

Definition
(GenBank) PTS fructose transporter subunit IIA
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
eav  Enterococcus avium
Pathway
eav00051  Fructose and mannose metabolism
eav02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:eav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EH197_20020
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    EH197_20020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eav02000]
    EH197_20020
Enzymes [BR:eav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     EH197_20020
Transporters [BR:eav02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    EH197_20020
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: QCQ14318
UniProt: A0A4P8KJ61
LinkDB
Position
complement(3935541..3935978)
AA seq 145 aa
MTAIIVSGHGQLSTGLLDAFQMIFGKDEKIVAIPFLKGEGIPQLQEKFQQQLEQFPPEEE
VLFMVDVFGGTPYNSATQLVFDKKNMDIVTGVNLPVLLEAGALKEALSISELTGALKTIN
QESFKVFSEQIKVIQEQETEEDDLL
NT seq 438 nt   +upstreamnt  +downstreamnt
atgacagcaattattgtaagtggacatggacaattatccaccggattattagatgctttt
caaatgatttttggtaaagatgaaaagatagttgcaattccctttttaaagggagaagga
attccgcagttacaagaaaaatttcaacaacagttagaacaatttccccctgaagaagaa
gtcttattcatggtagatgtcttcggaggaaccccgtacaattcagcgacacaattggtt
tttgacaaaaaaaacatggatattgtaactggtgtgaatcttccggtacttttggaagct
ggtgctttgaaagaagccctatccatttcagagttaacaggtgcattgaaaactatcaat
caagaaagtttcaaagtattttcggaacagattaaagtaattcaagaacaagaaactgag
gaggatgatttactgtga

DBGET integrated database retrieval system