KEGG   Enterococcus avium: EH197_21215Help
Entry
EH197_21215       CDS       T05982                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
eav  Enterococcus avium
Brite
KEGG Orthology (KO) [BR:eav00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EH197_21215 (ahpF)
Enzymes [BR:eav01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EH197_21215 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 DAO HI0933_like Thi4 FAD_oxidored AlaDh_PNT_C FAD_binding_3 FMO-like LPD7 Ribosomal_L21p K_oxygenase Glutaredoxin Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: QCQ14536
UniProt: A0A4P8KJW6
LinkDB All DBs
Position
4180383..4181924
Genome map
AA seq 513 aa AA seqDB search
MLDNETKEQLKQYLALLESKIVFSASLDGSEESKKVEDFLTEVAAMDDKILIETKNLKRT
PSFEINQVGADASGIVFAGLPMGHEFTSFILALLQVSGRAPKIDDALIQQIKLIDRELAF
ETYVSLTCHNCPDVVQALNIMSVLNPKILHTMIEGGMYQAEVDAKEVMAVPTVFLNDEEF
DSGRMTIEQIIEKVSGPLSADEFTDKETFDVLVIGGGPAGASSAIYAARKGIKTGMVVDT
FGGQVLETLGIENVIGTPYVEGPQLMRQVEEHVKQYDVDIMKGQRAKSIQKKDLIEVELE
NGAHLTTKTAILSTGARWRAINVPGEKEFKNKGIAYCPHCDGPLFKDKEVVVIGGGNSGI
EAAIDLAGLAKHIYVLEFLPELKADQVLQEKLHSLSNVTVITNAATKEITGSSHVEALTY
TDRLTNEEHTLNVEGVFILIGLMPNTEWLADTVALSDRGEILVDKHGATNVEGIFAAGDC
TDSTYKQIIISMGSGATAALGAFDHLIRQTIST
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttagataatgaaacgaaggaacagctaaaacaatatttagccttattagaatcaaag
atcgttttttcagcaagtttggatggatctgaagagtcgaaaaaagtagaagatttcttg
actgaagtcgcggcgatggatgataagattttgatcgaaaccaagaacttaaaacggaca
ccaagctttgagattaatcaggtgggggcagatgctagcggcatcgtctttgccggcttg
ccaatgggacacgaatttacttcattcattctagctttgctgcaagtcagcggtcgggcg
ccgaagattgatgatgcgctgatccaacaaatcaaattgattgatcgggagttagcattt
gaaacctatgtcagcctaacctgtcataactgcccggatgtcgtccaagcgttgaacatt
atgtctgtgttgaatccaaagattttacacaccatgatcgaaggcgggatgtaccaggca
gaagttgatgcaaaagaagtcatggccgtaccgactgtttttctaaacgatgaagaattt
gatagcggtcgaatgacgatcgaacagattatcgaaaaagtcagcggacctttgagcgcg
gatgaattcaccgataaagaaacctttgatgttttagtcattgggggcggtcccgctggt
gctagctcagcaatttatgctgctcgtaaaggaatcaagaccggaatggtcgtggatacc
ttcggcggtcaagtcttagaaacgctgggaatcgaaaatgtgatcggcacgccttacgtg
gaaggtccgcaattaatgcgtcaagtggaagaacacgtgaaacaatatgatgtagatatc
atgaaaggacaacgtgccaagtccattcagaaaaaggatttaatcgaagtcgaattagaa
aacggcgctcatttaacgacaaaaacagcgattctttcaacaggtgctcgctggcgtgcc
atcaatgttcctggtgaaaaggaatttaagaacaaaggcatcgcttattgcccgcattgt
gatggcccattgttcaaagataaagaagttgtggtgattggtggcggaaactcagggatt
gaagccgccattgacttagctggattagcgaaacatatttatgtactggaatttcttcct
gaactaaaggccgatcaagtgttgcaagaaaagcttcattcattgtcgaatgtcacggta
attaccaatgcagcaacgaaggagatcaccggttcttctcacgttgaagcattgacgtat
acggatcgtctaacaaatgaagaacataccttgaatgttgaaggggtcttcatcttgatt
ggtctaatgccgaacactgagtggttagccgatacagtcgccttgagcgatcgtggcgaa
attctagtagacaaacatggcgcaaccaatgtagaagggatttttgccgcaggtgattgt
acagacagcacctataagcaaatcattatctcaatgggctctggagctaccgccgctctt
ggcgcctttgaccatttgattcgtcaaacaattagcacatag

DBGET integrated database retrieval system