KEGG   Erwinia amylovora ATCC 49946: EAM_2119Help
Entry
EAM_2119          CDS       T01199                                 

Definition
(GenBank) putative zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:eay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EAM_2119
Enzymes [BR:eay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     EAM_2119
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     EAM_2119
    1.1.1.-  
     EAM_2119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N F420_oxidored ADH_zinc_N_2 Shikimate_DH NTP_transf_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBJ46794
LinkDB All DBs
Position
2272560..2273615
Genome map
AA seq 351 aa AA seqDB search
MKAARWHKAHDIRIEDIEEPLVSAGKVKIKVAWTGICGSDLHEYLAGPIFAPVGKPHKLS
HDVAPIVMGHEFSGKVVAVGNGVTKVKVGDRVVVEPVLSCRTCEACREGKYNLCADLDFH
GLSGGGGGFSSFTVVEEHMVHPMPEGLSYEQGALVEPAAVALHAVRMSKLKAGDKAAVFG
AGPIGLLMIEALRAAGASEIYVVELSPQRAEKARELGANVVIDPSQQDAVATIRERSKGG
VDVAFEVTGVPVVLKQCIDSSRYEGETIIVSIWEGEASFHPNTVVLAERNVKGIIAYRHI
FPAVMELMTQGYFQAEKLVTKRIDLADLVTEGFETLVKEKNQVKILVRPPQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctcgttggcataaagcccatgacattcggattgaagatattgaagaaccc
ctggtcagcgctggcaaggtaaaaattaaagtcgcctggacgggcatctgcggcagcgat
ctgcatgaatatctcgctggcccgatctttgcacctgtcggtaagccgcacaaactcagt
catgacgttgccccgattgtgatgggccacgagttctccggcaaggttgtcgcggtgggc
aacggtgtgactaaagtgaaagtgggtgaccgcgtggtggttgagcctgtcctctcctgc
cgtacctgtgaagcctgtcgcgaagggaaatataatctgtgcgcggatctcgattttcat
ggactgtccggcggcggcggtgggttttcctcctttaccgtggtcgaagaacatatggtg
catcccatgccagagggactttcgtatgagcaaggggcgctggtcgaaccggcagccgtg
gcgttgcacgcggtacggatgagcaagctgaaggccggagataaagcggcggtttttggc
gcgggaccgattggcctgctcatgattgaagccttgcgtgcagcaggtgcatcagagatt
tacgtggtcgagctgtcgccgcagcgggcagaaaaagcgcgcgagctgggagccaatgtg
gttatcgatcccagccagcaggacgcggtggctaccattcgtgaacggagcaaaggcggg
gtagatgttgctttcgaggtgaccggcgtaccggtggtgctgaagcaatgtatcgacagt
tcgcgttacgaaggcgaaacaatcatcgtttccatctgggaaggcgaggcttcgttccac
cccaatacagtggtgctggcagagcgtaacgtaaaaggtatcattgcctatcggcatatt
ttcccggcggtgatggagctaatgacccagggatatttccaggcagaaaagctggtgaca
aagcgcatcgatctcgcggacctggtgactgagggatttgaaacgctggtgaaagaaaaa
aaccaggtgaaaatactggttcgtccaccacaataa

DBGET integrated database retrieval system