KEGG   Erwinia amylovora ATCC 49946: EAM_2854
Entry
EAM_2854          CDS       T01199                                 

Definition
(GenBank) putative exported protein
Organism
eay  Erwinia amylovora ATCC 49946
SSDB
Other DBs
NCBI-ProteinID: CBJ47528
LinkDB
Position
complement(3118565..3119968)
AA seq 467 aa
MNRYLLMTGIWLAVSSLPAAAVDASLSSSGGSVSGAVSDGLFYSIGGGSVTSPPPGRSNM
SRLGLNGGWSSDLMCGNFDLKTTVGNQLNGITSGFKDLMGNVIQGATGAVMSMPAMAIQR
ANPGLYEMLTNGVLQAGLNFDKGQLNCQNMSKKLADYTMGSKWQQAAVSEEYKDIVAGSG
GDVVSSDQKLQKATGEEGVTWVGGEKRGGKGQRAIQPTRDLAKAGYNMMNGLPVTSNNSV
AAASCNGSACQRYKTSDEASAAVVKVLGDRSIRTCRETSECASGGSENQPGSTIAGSGFS
PLLEDATKENLEQLGKLVNGQLPPTADNLAGIRTGSLVVTRGVIQALRDDRDKAALVQRL
AGELAMADTVETALTMRRMLTTGQSEPNAAGQTEAIAEGDRRIDALDREIAALRNEMELR
KSISSNSLLTTLERQGARNQDNRLQQTSGSEDQGFGRMGQTQPTGAN
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgaacagatatcttctgatgaccggcatttggctggcagtatcctcgctgccggcagcg
gccgtggacgcgtcactctcttcttcaggcggttcggtaagcggggcggtcagcgacggc
ctgttttattccatcggcggtggatcggtgacctccccgccgcccggccgcagcaatatg
tcgcgcctggggctcaacggcggctggagcagcgacctgatgtgcggcaacttcgacctg
aaaaccaccgtgggtaaccagctcaacggtattaccagcggcttcaaggatctgatgggc
aacgttatccagggcgcgacgggggcggtgatgagcatgccggcgatggccatccagcgt
gcgaatccgggactgtatgaaatgctgactaacggcgtgctgcaggcgggccttaacttc
gacaaggggcagctcaactgccagaacatgtcgaagaagctggccgattacaccatgggc
agcaaatggcagcaggcagcggtgtcggaggagtataaggatatcgtcgctggcagcggc
ggtgatgtcgtctccagcgaccagaaactgcagaaggccaccggcgaggagggcgtcacc
tgggtagggggcgagaagcgcggaggcaaggggcagcgcgccatccagccaacccgtgac
ctcgccaaagcgggctacaacatgatgaacggcctgccggtcaccagtaacaacagcgtt
gctgctgccagctgcaacggcagcgcctgccagcgttacaaaacctctgacgaggcgtcg
gcggcggtggtaaaagtgctgggcgaccgctccatccgtacctgccgggaaaccagcgag
tgtgccagcggcgggagcgaaaaccagccgggcagcaccattgccggtagcggtttctca
ccgctgctggaagatgccaccaaagagaaccttgagcagctgggtaagctggttaacggc
cagctgccgccgaccgccgataacctggccgggatcagaaccggcagtctggtggtcacg
cgcggggtgatacaggcgctgcgcgacgatcgggataaggccgcgctggttcagcgtctt
gccggtgaactggcgatggccgacaccgtggagaccgcgctgaccatgcgccgtatgctc
accaccggtcaatcagaacctaacgccgccgggcagacggaagccattgccgaaggcgac
cgccgcatcgatgcgctcgatcgcgaaatcgccgccctgcgtaacgagatggagctgcgt
aaatccatcagcagtaacagcctgctgaccacgctggagcgtcagggggcgcgcaatcag
gacaaccgcctgcagcagacgtccggcagtgaggatcaggggttcggcaggatggggcag
acgcagccaacgggagcgaactga

DBGET integrated database retrieval system