KEGG   Erwinia amylovora ATCC 49946: EAM_3265Help
Entry
EAM_3265          CDS       T01199                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00564  Glycerophospholipid metabolism
eay01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eay00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EAM_3265 (glpD)
Enzymes [BR:eay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EAM_3265 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N GIDA Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CBJ47939
LinkDB All DBs
Position
3554700..3556205
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVGEALAEREVLLKMAPHIAFPMRFLLPHRPHLRPAWMIRMGLFMYDHLGKRTSLPGS
KSVRFGSDSVLKPEIVRGFEYSDCWVDDARLVVLNAQQVEKRGGEVRTRTRVTRAWRENG
LWTVEAEDIDSGKTLTWRAKGLVNAAGPWVKQLFDDGLKLKSPYGIRLIKGSHIVVPRVG
TQKQAYILQNEDSRIVFVIPWMDEFSIIGTTDVEYKGDAHDVKIDDNEIDYLLKVFNAHF
KQDLARDDIVWSYSGVRPLCDDESDSPQAITRDYTLDVHDDDGQAPLLSVFGGKLTTYRK
LAEHAMEKLSKYYPQAGAAWTKSCVLPGGNFAGTRDEYAVSLRRRFPFISVELARHYART
YGSNSEQLLKGATSLADLGELFGHHFYEAELRYLVENEWVRATDDALWRRTKEGMWLNQQ
QQARVGEWLAQHAKPLLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgtaatcggcggcggcattaatggtgccggcatcgcggct
gatgccgccgggcgcgggctgtcggtgctgatgctggaggcgcaagatctcgcctgcgcc
acctcttccgccagttcaaaactgatccacggcggcctgcgctatctggaacactacgaa
ttccgcctggtcggcgaagcgctggccgaacgcgaagtgctgctgaaaatggccccccat
attgcctttccgatgcgctttttgctgccacatcgcccgcatctgcgcccggcctggatg
atccgcatgggcctgtttatgtacgatcacctgggcaaacgtaccagcctgccgggcagt
aaaagcgtgcgttttggctcagactcggtactgaagcctgaaatcgtgcgcggtttcgaa
tattctgactgctgggtcgatgatgcccgtctggtggtgcttaacgcgcaacaggttgaa
aaacgtggcggcgaagtccgcacccgcacccgcgtcacgcgcgcctggcgtgaaaatggc
ctgtggaccgttgaagccgaagatatcgacagcggcaaaacccttacctggcgtgctaaa
ggtctggtcaatgccgccggtccgtgggtcaaacagctgtttgatgacggcctgaaactc
aagtcgccgtacggtatacggctgatcaagggcagccatatcgtcgtaccgcgcgttggt
acgcagaagcaagcctacattctgcagaatgaagatagccgtattgtgtttgtcatcccg
tggatggatgagttctcgattatcggtaccaccgacgttgagtacaaaggtgatgcgcat
gatgtcaaaatcgatgataacgagatcgattatctgctgaaggtgtttaacgcgcatttt
aagcaagacctggcccgcgacgatatcgtctggagctactccggcgtgcgcccgctgtgc
gatgacgagtcagattctccacaggccatcacccgcgattatacgctggatgtgcatgat
gatgacggccaggctccgctgctatcggtgtttggcggcaagctgaccacctaccgcaag
ctggccgaacacgcgatggaaaaactgagcaaatactacccgcaagcgggtgccgcctgg
accaaaagctgcgtgctgccgggcgggaactttgccggaacgcgtgacgaatatgccgtc
agcctgcgccgccgtttcccgtttatcagcgttgagctggcgcgccactatgcgcgtacc
tacggcagtaacagcgagcagctgcttaaaggtgctaccagcctggcagacctgggtgaa
ctgtttggccaccatttctacgaagccgaactacgctatctggtagaaaatgagtgggta
cgtgccaccgacgatgccctctggcgtcgtaccaaagaagggatgtggctgaatcagcag
cagcaggcaagggttggtgaatggctggcgcagcatgccaagccgctgttatcactggca
tcctga

DBGET integrated database retrieval system