KEGG   Aromatoleum aromaticum: ebA1167Help
Entry
ebA1167           CDS       T00222                                 

Gene name
ppc
Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00620  Pyruvate metabolism
eba00680  Methane metabolism
eba01100  Metabolic pathways
eba01120  Microbial metabolism in diverse environments
eba01200  Carbon metabolism
Module
eba_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ebA1167 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    ebA1167 (ppc)
Enzymes [BR:eba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ebA1167 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAI06736
UniProt: Q5P7H5
LinkDB All DBs
Position
677175..680147
Genome map
AA seq 990 aa AA seqDB search
MGRLVTEEWIGAARSKGLPQCNIRVGANGARAGRHSSMGANCAFRAPAGASPHHVSRRAN
RPLPQRSHPHPEQTMTEDKDAPLREDIRLLGRVLGDTVRDQHGEAAFALIERIRQTSVRF
RRDDDNAARLELEGILDALSREQTIEVVRAFSYFSHLSNIAEDQHHIRRSRAHLIAGSAP
REGSVAHALVRALASGLPPARLAAFFDTALISPVLTAHPTEVQRKSILNCETDIAHLLDA
RDRMTLTPEERQESDEALRRTVLTLWQTRMLRPAKLSVVDEVANGLSYFDATFLRELPHL
YANLEDQLVSRDPALAGLELPAFLQVGSWIGGDRDGNPFVTADVLERTLAMQAGAVLGFY
LDELHALGARLSLALGLVTASDALLALAARSPDHSPHRNDEPYRRAISGIYARLAATHHA
LLGTEPPRHPVAVAEPYAAVAELADDLDVIHRSLVANGSAALARGQLRRLRRAVRVFGFH
LAPIDLRQNSEVHERVVAELLATARTGTDYATLDEAARVELLIEELATPRPLASPHVRYS
DETEGELAIFRTARAAHRRYGGPAIPNCIISKTDDVSDLLELALLLKEAGLLRPHERALD
VNIVPLFETIEDLANAPSVMDRLFALPGYMNLLAASRDRTHEVMLGYSDSNKDGGFLTSG
WALYKAEIGLIEVFARHGIRLRLFHGRGGSVGRGGGPSYEAILAQPGGAVQGQIRLTEQG
EVIAAKYGNPEVGRRNLEVIVAATLEASLLADRAPAPRVEFLDTMQALSDVAFAAYRGLV
YDTEGFERYFWESTVISEIAELNIGSRPASRKKGTRIEDLRAIPWVFSWSQCRLMLPGWF
GFGSAVKTWLAAHADDGIARLQAMHREWSFFAALLSNMDMVLAKTDLAIASRYAGLVKDV
NLRDAIFERIRNEWHDTVDALLAITGQRELLDGNPLLKRSIRNRFPYLDPLNHVQVELLR
RHRETHDDARIRLGIHISINGIAAGLRNSG
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
gtgggcagactcgtcacggaggaatggatcggtgccgctcgcagcaaagggttgccgcaa
tgcaacatcagggttggcgccaatggcgcacgggctgggcggcattctagcatgggtgca
aattgcgcctttcgtgccccggcgggcgcaagtccccatcacgtcagccggcgagccaac
cggccgctcccacaacgtagccacccacacccggaacagaccatgactgaagacaaggac
gccccgctgcgcgaagacatccggctgctcggccgcgtgctgggcgacaccgtgcgcgac
cagcacggcgaagcggcattcgccctcatcgagcgcatccgccagacttcggtgcgcttc
cgccgcgacgatgacaacgcggcacggctcgaactcgaaggcatcctcgacgcgctgtcg
cgcgaacagacgatcgaagtcgtgcgcgcgttcagctatttctcgcacctgtcgaacatc
gccgaggaccagcatcacatccgccgcagccgcgcgcacctgatcgccggctcggcgccg
cgcgaaggcagcgtcgcgcacgcgctcgtgcgcgcactggcgagcggcttgccgccggcc
cggctcgcggcgttcttcgacaccgcgctgatctcgccggtgctgactgcgcatccgacc
gaagtccagcgcaagagcatcctcaactgcgagaccgacatcgcccacctgctcgatgca
cgcgaccgcatgacgctgactcccgaagagcgccaggaaagcgacgaggcgctgcgccgc
acggtgctgacgctgtggcagacgcgcatgctgcgcccggcgaagctgtcggtcgtcgat
gaagtcgcgaacggcctgtcgtatttcgacgcgactttcctgcgtgagctgccgcacctc
tatgcgaacctcgaagaccagctcgtgagccgcgacccggcgctcgccggcctcgaactg
ccggcgttcctgcaggtcggcagctggatcggcggcgatcgcgacggcaatcctttcgtc
actgccgacgtgcttgaacgcacgctcgcgatgcaggcaggggccgtgctcggcttctat
ctcgacgaactgcacgccctcggcgcgcgcctgtcgctcgcgctcgggctggtcaccgca
tccgatgcgctgctcgcactggccgcccgctcgcccgaccattctccccaccgcaacgac
gaaccctaccgccgcgcgatctccggcatctatgcgcggctcgcagcgacgcaccacgcg
ctgctcggcaccgaaccgccgcgccacccggtggcagtggccgaaccgtatgccgccgtc
gccgaactcgccgacgatctcgatgtcattcaccgctcgctcgtcgcgaacggctcggcg
gcgctcgcgcgcgggcagctgcgccggctgcggcgggcggtgcgcgtgttcggctttcac
ctcgcgccgatcgacctgcgccagaattccgaggtgcatgagcgcgtcgtcgccgaactc
cttgcgaccgccagaaccggtaccgactacgcgacgctcgacgaggcggcgcgcgtcgaa
ctgctgatcgaggaactcgcgacaccgcgtccgctcgcatcgcctcacgtgcgctattca
gacgagaccgaaggcgagctcgcgatcttccgcactgcgcgcgcggctcaccggcgctac
ggggggccggcgatcccgaactgcatcatctcgaagaccgacgacgtctccgatctgctc
gaactcgcgctgctgctgaaggaggcgggcctgctgaggccgcacgaacgggcgctggac
gtcaatatcgtcccgctgttcgagacgatcgaagatctcgcgaacgcgccgtcggtgatg
gaccgcctgttcgcgctgcccggatacatgaacctgctcgctgcctcccgcgaccgcacc
cacgaagtcatgctcggctattccgacagcaacaaggacggcggcttcctgacgtcgggc
tgggcgctctacaaggccgagatcggcctgatcgaggtgttcgcgcggcacggcatccgt
ctgcgcctgttccacggccggggcggttcggtcggacggggcggcggcccgagctacgag
gcgatcctcgcgcaacccggcggcgcggtgcaggggcagatccggctcaccgagcagggc
gaagtgatcgcggcgaaatatggcaacccggaagtcggccggcgcaacctcgaagtcatc
gtcgccgcgacgctcgaagcgagcctgctcgccgatcgcgctcccgcgccgcgcgtcgag
ttcctcgacacgatgcaggcgctgtcggacgtcgcgttcgctgcgtaccgcgggctggtc
tacgacaccgaagggttcgaacgctatttctgggaatcgaccgtgatctcggagatcgcc
gagctgaacatcggctcgcggcccgcgtcgcgcaagaaaggcacgcgcatcgaggatctg
cgcgcgatcccctgggtgttcagctggtcgcagtgccgcctgatgctgccgggctggttc
ggcttcggcagcgcagtcaaaacctggctcgcagcccacgctgacgacggcatcgcccgc
ctgcaggcgatgcatcgggaatggtcgttcttcgccgcgctgctgtcgaacatggacatg
gtgctggcgaagaccgatctggcgatcgcgtcacgctacgccgggctcgtcaaggacgtc
aacttgcgcgatgcgatcttcgagcgcatccgcaacgaatggcacgacaccgtcgacgcg
ctgctcgcgatcaccggccagcgcgagctcctcgacggcaacccgctgctcaagcgctcg
atccgcaaccgcttcccctacctcgatccgctcaaccacgtacaggtcgagctgctgcgc
cgccatcgcgagacgcatgacgacgcgcgcatccggctcgggatccacatctcgatcaac
ggcatcgcggccggtttgcgcaacagcggctaa

DBGET integrated database retrieval system