KEGG   Aromatoleum aromaticum: ebA1442Help
Entry
ebA1442           CDS       T00222                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine synthetase) (D-Ala-D-Ala ligase), gene: DDL OR DDLB OR NE0994
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00473  D-Alanine metabolism
eba00550  Peptidoglycan biosynthesis
eba01100  Metabolic pathways
eba01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ebA1442 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ebA1442 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ebA1442 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eba01011]
    ebA1442 (ddlB)
Enzymes [BR:eba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ebA1442 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:eba01011]
 Precursor biosynthesis
  Amino acid ligase
   ebA1442 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST RimK TTL
Motif
Other DBs
NCBI-ProteinID: CAI06913
UniProt: Q5P6Z8
LinkDB All DBs
Position
complement(853320..854249)
Genome map
AA seq 309 aa AA seqDB search
MRGNGVGAKFGKVAVLLGGTSAEREVSLMSGGAVLAALQAAGVDAHGFDPAQQDLHILKE
QGFDRAFIALHGRGGEDGTVQGLLELLKIPYTGSGVMASALAMDKWRTKMVWAACGLPTP
RYAILAGDTDWEAVVAELGLPIFVKPVHEGSSMGATKVTAASQLKAAWERAARFDDLVLA
EEFIVGAELTVPFLAERALPVIRIEAPGGKYDYQNKYFTDETRYLCPSGLPAEQEQALQA
LVMKSARALGCRGWGRADLMLTGDGRPYLLEMNTSPGMTGHSLVPMAAKAVGLDFTALCL
AILEDARLG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgaggggcaacggcgtgggggcaaaattcgggaaagtcgcagtgctgctcggcggcacg
tccgcggagcgggaagtctcgctgatgtccggcggtgcggtgctggcagcgttgcaggca
gctggggtcgacgcacatggcttcgacccggcgcagcaggacctgcacatcctcaaggag
cagggcttcgaccgggcgttcatcgcgctgcatggccgcggcggcgaggacggcacggtg
caggggctgctggaactgctgaagatcccttacaccggcagcggcgtgatggcctccgcg
ctggccatggacaaatggcgcacgaaaatggtgtgggccgcatgcggcctgccgacaccg
cgctacgcgatcctcgccggggataccgactgggaggccgtcgtcgccgagttggggctg
ccgatcttcgtcaagccggtgcatgaaggctcgagcatgggcgcgacgaaagtcaccgcg
gcgagccagctcaaggcggcgtgggagcgcgcggcgcgcttcgatgacctcgtgctggcc
gaggaattcatcgtcggcgccgagctgacggtgcctttcctcgccgagcgtgcgctgccg
gtgatccgcatcgaggcgccgggcgggaaatatgactatcagaacaagtatttcaccgat
gaaacccgctacctgtgcccaagcggcctgcccgccgaacaggagcaggcgctgcaggcg
ctggtgatgaagagcgcgcgcgcgcttggctgccgcggctggggtcgcgccgatctgatg
ctgaccggggacggccggccgtacctgctcgagatgaacacttcgcccggcatgaccggc
cattcgctggtgccgatggcggccaaagccgtcgggctggacttcaccgcgctgtgcctg
gcgatcctcgaggacgcgcgtcttggctga

DBGET integrated database retrieval system