KEGG   Aromatoleum aromaticum: ebA1961
Entry
ebA1961           CDS       T00222                                 

Gene name
badK
Definition
(GenBank) Cyclohex-1-ene-1-carboxyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00362  Benzoate degradation
eba01100  Metabolic pathways
eba01120  Microbial metabolism in diverse environments
eba01220  Degradation of aromatic compounds
Module
eba_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ebA1961 (badK)
Enzymes [BR:eba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     ebA1961 (badK)
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Other DBs
NCBI-ProteinID: CAI07207
UniProt: Q5P654
LinkDB
Position
1153185..1153958
AA seq 257 aa
MNLVILVETRHKVGLIRINRPEVHNALNDDVMTELGRALDAFEADRSIACVVLTGSEKAF
AAGADIAAMRAMDFMDAYKSDFITRNWERLRTFRKPVIAAVNGVALGGGCELAMMCDIVF
AADNARFGQPEIKIGTIPGAGGTQRLPRAIGKTKAMDMCLTGRLMDAQEAERSGLVARIF
PAGTVLDEALATAAQLAEYSLPVLMMMKESVNRAYESPLSEGLLFERRTLHATFALADQK
EGMNAFVEKRTPQFAHC
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaatctcgtaatcctcgtcgaaacccggcacaaggtcggcctgatccgcatcaacagg
cccgaagtgcataacgcgctcaacgatgacgtgatgaccgagctcggccgcgcgctcgac
gcgttcgaggccgaccggagcattgcctgcgtcgtgctgaccggctccgaaaaagctttc
gccgccggcgccgacatcgcggcgatgcgcgcgatggacttcatggacgcctacaagtcg
gacttcatcacgcgcaactgggagcggctgcgcactttccgcaagccggtcatcgcggcg
gtgaatggggtcgcgctcggcggcggctgcgagctggcgatgatgtgcgacatcgtcttc
gctgccgacaacgcccgtttcggccaacccgagatcaagatcggcacgattcccggcgcc
ggcggcacgcaacgcctgccgcgcgcgatcggcaagaccaaggcgatggacatgtgtctg
accggtcgcctgatggacgcgcaggaagccgagcgcagcgggctcgtcgcacgcatcttc
ccggccggcacggtactcgacgaggcgctcgcgaccgccgcgcagctcgccgagtattcg
ctgccggtgctgatgatgatgaaggagtcggtcaaccgtgcatacgagagcccgctcagc
gaagggctgctgttcgagcgccgcacgctgcacgcgacgtttgcgctcgctgaccagaag
gaaggcatgaacgcgttcgtcgagaaacgcacgccgcagttcgcgcactgttag

DBGET integrated database retrieval system