KEGG   Aromatoleum aromaticum: ebA1984Help
Entry
ebA1984           CDS       T00222                                 

Definition
(GenBank) putative glutathione S-transferase P subunit
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ebA1984
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eba02000]
    ebA1984
Enzymes [BR:eba01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ebA1984
Transporters [BR:eba02000]
 Other Transporters
  Pores ion channels [TC:1]
   ebA1984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: CAI07220
UniProt: Q5P641
LinkDB All DBs
Position
1172390..1173118
Genome map
AA seq 242 aa AA seqDB search
MRYELYYWPSIQGRGEFVRLLLEEAGADYVDVARLPEENGTGLPALLRLLGGESLEHVPF
APPFLKAGDLVIGQTANILLYLGPRLRLAPKTEAGRHWAHQLQLTIADLVGEIHDTHHPI
ASSLYYEDQKPEALRRAKDFTKNRLPKFLGYFEQVRAQNSFRSGYLVGDTLSYVDLSMFQ
VVAGLRYAFPRTMSRLEPGCPGLVELHRRVARRPRLVAYLASERRLPFSEEGIFRHYPEL
DR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgaactgtattactggccgtcgatccaggggcgcggcgaattcgttcgcctg
ctgctcgaagaagcgggcgccgactatgtcgacgttgcccgcctgccggaggaaaacggt
acgggcctgccggcgctgctgcggctcctgggcggcgaatcgctcgaacacgtgccgttc
gcgccgccgttccttaaagcgggcgacctcgtgatcgggcagaccgccaacatcctgctg
tatctcggcccgcggctccgcctcgcgccgaagaccgaggcggggcggcactgggcgcac
cagctgcagctgacgattgccgacctcgtcggcgaaatccacgacacccaccacccgatc
gcgagcagcctgtattacgaagatcagaagcccgaagcgctgcgccgcgccaaggacttc
acgaagaaccggctaccgaagttcctcggctatttcgagcaggtccgcgcgcagaacagc
tttcgcagcggctacctcgtcggcgacacgctgtcgtacgtcgacctgtcgatgttccag
gtcgtcgcaggcctgcgctacgcgttcccgcgcacgatgtcgcgcctcgaaccgggctgt
ccaggcctcgtcgagcttcaccgccgcgtcgcccggcgcccgcgcctcgtcgcgtatctc
gcgtcggagcggcgcctgccgttcagcgaagagggcattttccgccattacccggaactc
gaccgttag

DBGET integrated database retrieval system