KEGG   Aromatoleum aromaticum: ebA3040Help
Entry
ebA3040           CDS       T00222                                 

Definition
(GenBank) Penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00550  Peptidoglycan biosynthesis
eba01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ebA3040
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ebA3040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eba01011]
    ebA3040
Enzymes [BR:eba01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ebA3040
Peptidoglycan biosynthesis and degradation proteins [BR:eba01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ebA3040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CAI07838
UniProt: Q5P4C5
LinkDB All DBs
Position
1812690..1814618
Genome map
AA seq 642 aa AA seqDB search
MTEFRTPEEELGRFRRRVLVAGIVALVCFGLLAARFYYLQVVRHDYFLTRAEDNRIGLVP
IVPTRGAILDRNGVTLARNFAAYTLEITPSQVADLDETIDALSEIVTIDARDRRRFRKLL
EESRNFESVPIRTRLDDAEVARFVARRYRFPGVEVQARLFRDYPQGEVASHVIGYIGRIN
LRDQERIEERGDTANYRGSDHIGKSGLELSYETELHGVTGVEQVEVNAGGRAVRVISRTP
ATTGSDLELTLDIELQKVAEAAFGDRRGALVAIDPRTGGVLALASKPAFDPNLFVDGIST
ADWNELNDSPDHPLLNRAIFSAYPPGSTFKPFMALAALTTGKRTANQAIADPGYFSFAGR
RFMDDKVGGHGTVDLHKSIVVSCNTYYYQLANDLGIEEIAGFMAPLGFGSRTGIDIPGEA
EGVLPSPAWKRGRFKKPEQQRWYGGETISVGIGQGYNAYTPVQLANALATIVNGGKVFRP
HVVRHVIDTASGERRAIQPEPLRQLAIKPAHLAAVREAMVDVNKSGTGARAFAGAPYSAG
GKTGTAQVYSLKGSKYVAGRVRERLRDHSWFIAYAPAENPTIALAVLVENGGFGAQSAAP
IARQVIDYHLLGARLDAPAREDAEAAEAEDDTHAGHDAEPTP
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaattccgcactcccgaggaggaactggggcgctttcgccgccgggtgctggtt
gcgggcatcgtcgcgctggtgtgcttcggcctgctcgcggcgcgcttctattacctccag
gtggtccgccacgactactttctcacgcgcgccgaggacaaccgcatcggcctcgtgccg
atcgtgccgacgcgcggtgcgatcctcgaccgcaacggcgtgacgctggcgcgcaacttc
gccgcctacacgctcgagatcacgccgtcgcaggtcgccgatctcgacgagacgatcgat
gccttgagcgagatcgtgacgatcgatgcgcgcgaccggcggcgctttcgcaagctgctc
gaggagagccgcaacttcgagagcgtgccgatccgcacgcgcctcgacgacgccgaagtc
gcgcgcttcgtcgcccggcgctaccgctttcccggcgtcgaagtccaggcgcgcctgttc
cgcgactaccctcagggcgaagtcgcttcgcacgtcatcggctacatcgggcggatcaac
ctgcgcgaccaggaacgcatcgaggagcgcggcgacaccgcgaactatcgcggctcggac
cacatcggcaagagcgggctggagctcagctacgagacagaactccatggcgtgaccggc
gtcgagcaggtcgaggtgaacgccggcgggcgcgcggtgcgggtgatatcgcgcacgccc
gcgacgacgggcagcgatctcgagctgacgctcgacatcgagctgcagaaagtcgccgag
gccgcgttcggcgaccggcgcggcgcgctcgtcgcgatcgacccgcgcactggcggcgtg
ctggcgctcgcgtcgaaaccggcattcgacccgaacctgttcgtcgacggcatctccacc
gccgactggaatgaactcaacgattcgccggaccatccgctgctcaaccgcgcgatcttc
agcgcctatccgcccggatcgacgttcaagccgttcatggcgctcgcggcgctgacgacc
ggcaagcgcaccgcgaaccaggcgatcgccgatccaggttacttcagcttcgccggacgc
cgcttcatggacgacaaggtcggcggccacggcacggtcgacctgcacaagtcgatcgtc
gtgtcgtgcaacacctattattaccagctcgcgaacgatctcggcatcgaagagatcgcc
gggttcatggcaccgctcggcttcggttcgcgcaccggcatcgacattcccggcgaagcc
gaaggcgtgctgccgtcgccggcgtggaagcgcggccgcttcaagaagcccgagcagcaa
cgctggtacggcggcgagacgatctcggtcggcatcggccaggggtacaacgcctacact
ccggtgcagctcgcgaacgcgctggccacgatcgtcaacggcggaaaggtgttccggccg
catgtcgtgcgccacgtgatcgacacggcgagcggcgagcggcgagcgatccagcccgag
ccgctccgccagctcgcgatcaagccggcgcatctggccgcggtgcgcgaggcgatggtc
gacgtcaataagtccgggaccggtgcgcgcgccttcgccggcgccccgtacagtgccggc
ggcaagaccggcaccgcgcaggtgtattcgctcaaagggtcgaaatacgtcgccggccgg
gtccgcgagcggctgcgcgaccactcgtggttcatcgcgtacgcgccggcggagaatccg
acgatcgcgctcgcggtgctggtcgagaacggcggcttcggcgcccagtcggcagcgccg
atcgcgcgccaggtcatcgactaccatctgctcggcgcgcgtctcgacgcacccgcgcgc
gaagacgccgaggcggcggaagccgaggacgacacccacgccggacacgacgcggagccg
actccgtga

DBGET integrated database retrieval system