KEGG   Aromatoleum aromaticum: ebA3044Help
Entry
ebA3044           CDS       T00222                                 

Definition
(GenBank) putative penicillin-binding protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00550  Peptidoglycan biosynthesis
eba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ebA3044
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eba01002]
    ebA3044
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eba01011]
    ebA3044
Enzymes [BR:eba01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ebA3044
Peptidases and inhibitors [BR:eba01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ebA3044
Peptidoglycan biosynthesis and degradation proteins [BR:eba01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ebA3044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Transpeptidase Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: CAI07841
UniProt: Q5P4C2
LinkDB All DBs
Position
1816727..1817932
Genome map
AA seq 401 aa AA seqDB search
MPVRPTIIAGSAVPSLPHLPVLPQVLMRLFIVLLLALLAFPASAQNVPAPTLAAKSWLLM
DHATGQVLAAQEPDARIEPASLTKLMTAYLTFAALKNGTITLDQTVPVSNKAWRSEGSRM
FIEPNRPVTVGELTSGMIIQSGNDACVALAELLAGSEEAFAHMMNAEAQRLGMKNTHFTN
STGLPDPQLYTTARDLGLLAAAIVRDFPEYYRYYSQKEYTYNKITQPNRNRLLWLDTTVD
GLKTGHTSSAGYCLISSAQRGPRRLISVMLGTDSDTIRAQESLKLLNYGFQFHDTVKLYS
ADQELSRFQVWKGQADDVAVGFLGDFVMSLPKGQSEKIEASLVSQQPVIAPIQKGQPIGT
LHLTLDGKPLGEHAVVALQDVPVAGFFGRLWDTLLLWIKSL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgttcgacccactataatcgcaggctccgctgttccttcccttcctcaccttccg
gttctccctcaggtcctcatgcgtttattcattgtcctgcttcttgcgttgctcgccttt
cccgcttcagcccagaatgtccccgcgccgacgctggctgccaaatcctggctgctgatg
gatcacgccaccgggcaggtgctcgcggcgcaggaaccggacgcgcgtatcgaaccggct
tcgctgacgaagctgatgacggcttacctgacgttcgcggcgctgaagaacggcacgatc
acgctcgatcagacggtgccggtgtcgaacaaagcctggcgcagcgaaggctcgcggatg
ttcatcgaaccgaaccggcccgttaccgtcggcgaactcacttcggggatgatcatccag
tccggcaacgacgcgtgcgtcgcgctggccgagctcctcgccggttccgaggaagcgttc
gcgcacatgatgaacgccgaagcccagcgcctcggcatgaaaaacacccacttcacgaac
tcgaccggcttgcccgacccgcagctctacaccaccgcgcgcgacctggggctgctcgcc
gcggcgatcgtgcgcgacttccccgagtattaccgctattactcccagaaagagtacacg
tacaacaagatcacccagccgaaccgcaatcgcctgctgtggctggacacgaccgtcgac
ggcctgaagaccggccacaccagcagcgccggctactgcctgatttcgtcggcacagcgc
ggtccgcgccgcctgatctcggtcatgctcggcaccgattcggacacgatccgcgcgcaa
gagtcgctgaaactgctgaactacggcttccagttccacgacaccgtcaaactctattcg
gccgaccaggaactgtcgcgcttccaggtgtggaaaggccaggccgacgacgttgcggtc
ggcttcctcggcgacttcgtgatgtcgctgccgaaagggcagtcggagaaaatcgaggct
tcgctggtcagccagcagccggtcattgcgccgatccagaaaggccagccgatcggcacg
ctgcacctgactctcgacggcaagccgctcggcgaacacgcggtcgtcgcgctgcaggac
gtgccggtggccggcttcttcggccgcctgtgggatacgctgctgttgtggatcaagagc
ctgtaa

DBGET integrated database retrieval system