KEGG   Aromatoleum aromaticum: ebA4625Help
Entry
ebA4625           CDS       T00222                                 

Gene name
aldB
Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00010  Glycolysis / Gluconeogenesis
eba00620  Pyruvate metabolism
eba01100  Metabolic pathways
eba01110  Biosynthesis of secondary metabolites
eba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ebA4625 (aldB)
   00620 Pyruvate metabolism
    ebA4625 (aldB)
Enzymes [BR:eba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     ebA4625 (aldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAI08745
UniProt: Q5P1R9
LinkDB All DBs
Position
complement(2733703..2735217)
Genome map
AA seq 504 aa AA seqDB search
MNKLDPARYGLNLKGRYGNYIGGQWLPPVAGRHFDNITPITGKPLCEIPRSDEQDVELAL
DAAHKAKAAWGRTSAAERAGVLNRIADRMEANLETLAQVETWDNGKPIRETRAADIPLAI
DHFRYFAACVRAQEGSLGEIDHTTVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALAAG
NCVVLKPAEQTPLSILVFAELVGDLLPPGVLNIVNGFGVEAGKPLASSKRIAKIAFTGET
GTGRLIMGYASQNLIPVTLELGGKSPNIFFDDVAAQDDAFFDKAIEGFVMFALNQGEVCT
CPSRALIHESIYERFIERALKRVAEIRQGNPLDPATMIGAQASREQMDKIQSYLAIGRDE
GAELLAGGERAHLDGELEGGFYIQPTVFRGHNKMRIFQEEIFGPVVSVTTFKDRDEALAI
ANDTPFGLGAGVWTRNINTAFHMGRHIEAGRVWTNCYHAYPAHAAFGGYKQSGMGRETHK
MMLDHYQQTKNLLVSYSEDKLGFF
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcttgaccccgcccgctacggcctgaacctgaaaggccgctacggcaactac
atcggcggccagtggctgccgccggtcgccgggcgccacttcgacaacatcaccccgatc
accggcaagccgctctgcgagattccgcgctccgacgagcaggacgtcgagctcgcgctc
gatgccgcgcacaaggccaaggccgcgtggggccggacgagcgccgccgagcgcgcaggg
gtgctgaaccgcatcgccgaccgcatggaagcgaacctcgagacgctcgcgcaggtcgag
acctgggacaacggcaagccgatccgcgagacgcgcgcggccgatatcccgctcgcaatc
gaccacttccgctacttcgccgcatgcgtgcgcgcgcaggaaggcagcctcggcgagatc
gaccacaccacggtcgcgtaccacttccacgagccgctcggcgtcgtcggccagatcatc
ccgtggaacttcccgctgctgatggcggcgtggaagctcgcgccggcgctcgccgccggc
aactgcgtggtgctcaagccggccgagcagacgccgctgtcgatcctcgtgttcgcggaa
ctggtcggcgatctgctgccgccgggcgtgctcaacatcgtcaacggcttcggcgtcgag
gcaggcaagccgctcgcgtcgagcaagcggattgcgaagatcgccttcaccggcgaaacc
ggcaccggccggctgatcatgggctacgcgagccagaacctgattccggtgacgctcgag
ctcggcggcaagtcgccgaacatcttcttcgacgatgtcgcagcgcaggacgacgcgttc
ttcgacaaggcgatcgaaggcttcgtgatgttcgcgctgaaccagggcgaagtgtgcacc
tgcccgagccgcgcgctgattcatgaatcgatctacgagcgcttcatcgagcgcgcattg
aaacgcgtcgccgagatccgccagggcaacccgctcgatccggccacgatgatcggcgct
caggcctcgcgcgagcagatggacaagatccagagctacctcgcgattgggcgcgacgaa
ggtgccgagctactcgccggcggcgagcgtgcgcacctcgacggcgagctcgaaggcggc
ttctacatccaaccgacggtgttccgcggccacaacaagatgcgcatcttccaggaggag
attttcggcccggtggtgtcggtgacgacgttcaaggaccgcgacgaggcgctcgcgatc
gcgaacgacacgccgttcgggctcggcgccggcgtatggacgcgcaacatcaacaccgcg
ttccacatgggccgccacatcgaagccggccgcgtatggacgaactgctaccacgcctac
ccggcgcacgcagcgttcggcggctacaagcagtcgggcatgggccgcgagacgcacaag
atgatgctcgatcactaccagcagacgaagaacctgctcgtgagctacagcgaagacaag
ctcggcttcttctga

DBGET integrated database retrieval system