KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_05585
Entry
C2U52_05585       CDS       T05417                                 

Definition
(GenBank) conjugative transfer ATPase
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_10 AAA_22 AAA_7
Other DBs
NCBI-ProteinID: AUV05794
UniProt: A0A2I8QIF4
LinkDB
Position
complement(759313..762111)
AA seq 932 aa
MAFSLFRRRAEAQEAHQYGDGPFSVNGHEPLTREGRLTRSEEAKLYETAPSIIDHIPWGE
YLPEHQCILLDDGVSVGAVYEIIPVGTEGRPDSRLEEIRDVVENALQDSLPELDTHQWVV
QFYCQDESDLMVYMDKIRGYVKPRAQGTDFTDAWLREQARHLQNVATEKGLFVDEAVTGA
PWRGQIRRTRMVIYRWVESPYRDPMAPEVLLKQVCDRLTAAMSGAGIQCQRQNGEQIHSW
LLRWFNPEPTWVDKATLYRCARHTDDAPGELPLLNDFSESLWFTRPRSDAEKGVWWFDDV
AHRAVPVARLRSAPTTGHLTGEVRRGDNINAIMDLLPEGTVLVMTLVIHPQDKLEENFAR
LSRDSMGENVDSLRAREDAATARTYLGNKHKLYRAAITLLIKARDLPSLDSRYLDLSSKL
LNCGLEPVNPEHDIGPLSTYMRALPMCFNPEQDRHNWYTRLMFVQHFACLAPVYGRDTGT
GNPGFTFFNRGGGPLSVDPLNKNDRTQNAHLLLFGPTGAGKSATALDKLAQMIAIYRSRI
FLLEAGNSFGLAGDYFESLGLTVHRVSIKPGKAISLAPFGDSHLLMQEKPDELIISEDAL
PDIDDDEDKDEKRDVLGEMEIAARLMITGGEPAEEQRMTRADRGMIREAIMIAARSTFEA
GRQMLPEDLMFALQGIARDAGMGEDGRERRTAARRARAEEMSEALRMFTEGFEGELFNRP
GTPWPEADVTIVDLGTLAREGYEAQMAVAVISLLNTINNIAEREQYSDRDIIVSIDEAHI
VTANPLMGPYATKIVKMWRKLGAWLWLFTQNLADFPDTAKKMLNMAEWWICLVMPPDEVE
QIARFKTLNSEQKAMLLSATKLPKKYTEGVILSRKVQALFRAVPPSLYLALGMTEKEEKA
ERRLIMNELQCSELEAAFHVARRLDENRGLSI
NT seq 2799 nt   +upstreamnt  +downstreamnt
atggccttttcacttttccgtcgcagggctgaagcgcaggaagcacaccagtacggtgac
gggccgttttctgttaacggccatgaacccctgacgcgcgagggacgtctgacccgcagc
gaggaagcgaagctgtatgagacggctccgtccatcatcgatcacattccctggggggaa
tatctccctgaacatcagtgcatcctgcttgatgacggcgtgtcggtcggggcagtttac
gaaatcatcccggtgggcaccgaggggcgtccggattcccgcctggaggaaattcgcgac
gtggtcgaaaacgccctgcaggacagtcttccggagctggatacacatcagtgggtggtg
cagttctactgtcaggacgagtctgacctgatggtgtatatggataagatccgggggtat
gttaagccccgggcgcagggcaccgacttcaccgacgcctggctgagggaacaggcccgt
catctgcagaatgtggccactgaaaaaggcctgtttgtcgatgaggccgtcaccggtgcg
ccgtggcgcggtcagatacgtcgtacgcgtatggtcatctaccgctgggtggagtcaccg
tatcgtgacccgatggcccccgaggtgctgctgaagcaggtctgcgatcgcctgacggcc
gccatgagcggtgccggtattcagtgccagcgccagaacggcgagcagatccacagctgg
ctgctgcgctggttcaaccctgaaccaacgtgggtggataaggccacactgtatcgctgt
gccagacatactgacgacgctcctggcgaactgccgttgctgaatgatttcagtgaaagc
ctgtggttcacccgcccccgcagtgatgcggagaaaggcgtatggtggtttgatgacgtg
gcgcacagggcggtgccggtggctcgtctgcgcagcgcacccaccacggggcacctgacc
ggcgaggtccgccgtggcgataatatcaacgccattatggacctgctgccggaaggtacg
gtgcttgtcatgacgctggttatccatccgcaggacaagctggaggaaaactttgcccgg
ctgagtcgtgactcgatgggggagaacgtggattcgctgcgtgcccgggaggatgcggcc
accgcccgcacttacctgggtaataagcataaactgtatcgcgcggccattaccctgctg
attaaagcccgcgacctgccttcactggacagtcgctatctcgacctcagcagtaagcta
ctgaactgcgggctggagccggtaaacccggagcatgatatcgggccgctcagcacctac
atgcgtgcattacccatgtgctttaatccggagcaggaccggcacaactggtatacccgt
ctgatgttcgtgcagcattttgcctgcctggcgccggtgtacgggcgtgataccggcacc
ggcaacccgggctttaccttttttaaccggggcggtggtccgctgtccgtcgatcccctc
aacaaaaatgaccgtacgcagaacgcccacctcctgctgtttgggccgaccggtgcaggt
aaatcggctaccgcacttgataagctggcacaaatgatagccatttaccgttcacgtatc
tttttactggaggcgggtaacagcttcgggctggccggagactactttgagtccctggga
ctcaccgttcatcgtgtcagcatcaagcccggtaaggccatctcgctggcgccgttcggt
gattcgcatctgctgatgcaggaaaaaccggatgaactcattatcagtgaagacgccctg
ccggatattgatgacgatgaggacaaggatgaaaaacgtgatgtgctgggtgagatggag
attgcagcacgcctgatgattaccggcggcgagccagcggaggagcagagaatgacgcgc
gccgatcgcgggatgatccgggaagccatcatgatcgctgcgcggagtacgtttgaggcc
ggacggcagatgttgcctgaagatctgatgtttgcgctgcagggcatcgcccgggatgcc
gggatgggtgaggacgggcgcgaaaggcgtacggccgcgcgccgggcccgtgctgaggaa
atgtcggaagcgctacggatgtttaccgaaggctttgaaggtgagctgtttaaccgtccg
ggtacgccgtggccggaggctgatgtgaccatcgttgaccttggtacgctggcgcgcgaa
ggctatgaggcgcagatggccgttgcggtgatttccctgctcaacaccatcaacaatatt
gctgagcgcgagcagtacagtgaccgggatattatcgtgtcgatcgatgaggcgcatatc
gtgaccgcaaatcccctgatggggccttatgccaccaagattgtgaaaatgtggcgtaag
ctgggtgcctggctctggctgttcacgcagaacctggccgactttccggatacggccaaa
aagatgctcaatatggcggagtggtggatttgtctggtgatgccccctgatgaagtggag
cagatagcgcgttttaaaacgctgaacagtgaacagaaggcgatgctgttgtctgccacc
aaacttcctaaaaaatatacggaaggcgttattttgtcacgtaaggtgcaggccctgttc
cgtgccgtgcccccgagcctctaccttgctctgggtatgacagaaaaagaagagaaagct
gaaagacgcctcattatgaatgaattacagtgcagtgaacttgaggctgcgtttcatgtt
gcgcgccggcttgatgaaaatcgcggactgagtatctga

DBGET integrated database retrieval system