KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_09940Help
Entry
C2U52_09940       CDS       T05417                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Pathway
ebc00250  Alanine, aspartate and glutamate metabolism
ebc00410  beta-Alanine metabolism
ebc00640  Propanoate metabolism
ebc00650  Butanoate metabolism
ebc01100  Metabolic pathways
ebc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C2U52_09940
   00650 Butanoate metabolism
    C2U52_09940
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C2U52_09940
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C2U52_09940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ebc01007]
    C2U52_09940
Enzymes [BR:ebc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C2U52_09940
Amino acid related enzymes [BR:ebc01007]
 Aminotransferase (transaminase)
  Class III
   C2U52_09940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUV10475
UniProt: A0A2I8QWZ6
LinkDB All DBs
Position
1656764..1658029
Genome map
AA seq 421 aa AA seqDB search
MKNNELHQRRLQATPRGIGVMCGFYAEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
IVAAVEKQLQAFTHTAYQIVPYESYVSLAERINERVPVEGPAKTAFFSTGAEALENAVKI
ARAYTKRPGVITFGGGFHGRTYMTMALTGKVAPYKIGFGPFPGSIFHAQFPNALHGVSTE
DAMKSLDRIFKADIAPDQVAAILLEPVQGEGGFNIAPDDFMQALRKLCDTHGILLITDEV
QSGFARTGKLFAVEHYSVKPDLITMAKSLAGGLPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVMDVIEEENLCERANHLGKHLVEVLTKAKADCPYIADIRAQGSMVAVEFND
PQSGEPSAEFTKQVQDKALAAGLLLLSCGVYGNVIRFLYPLTIPEVQFRKALDIIYQSLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaataacgaattacatcaacgccgtttacaggcgacaccgcgtggtattggcgtg
atgtgcggcttctatgccgagaaagcagaaaatgccactctgtgggatgtggaaggcaac
gaagtcatcgatttcgccgccgggattgcggtgcttaataccggccatcgccatcctaaa
attgtcgcagcagtggaaaagcagttgcaggcctttacccacacggcttatcagattgtc
ccttacgaaagctacgtctcgctggcggaacgcattaacgaacgcgtaccggtagaaggc
ccggccaaaacagcctttttctcgaccggggcggaagcgctggaaaacgcggtcaaaatc
gcccgcgcctataccaaacgtcctggtgtgattactttcggcggaggtttccacggacgt
acctatatgaccatggcgctgaccggcaaagtggcaccgtacaaaatcggttttggcccg
ttccctggttccattttccatgcgcaattcccgaatgcgctgcacggcgtcagtactgaa
gatgctatgaaaagcctggatcgtatttttaaagcggatatcgcccccgatcaggttgca
gccattttactcgagccggtacagggcgaaggcggctttaatatcgcgccagacgacttt
atgcaggcgttgcgtaagttgtgtgatacccatgggattttgttgattaccgatgaagtg
cagtccggctttgcgcgtaccggtaaactcttcgcggtggaacattacagcgttaaacct
gacttgatcaccatggcgaaaagcctggcgggcggcctgccgctgtcagcagtggcgggg
cgtgcggaagtgatggacgcacccgcgccgggggggttaggcggtacttatgccggtaac
ccgctcgccgtggccgctgcgcatgccgtgatggatgtgatcgaagaggagaatctctgc
gaacgcgccaaccacctgggtaagcatctggttgaagtgctgaccaaagcgaaagcggac
tgtccgtacattgcggatattcgcgcccagggttctatggtggccgtggagtttaacgat
ccgcaaagcggtgaaccgtcggcggaattcactaagcaggtgcaggataaagcgctggcc
gccgggctgttgctgttgagttgcggtgtctacggtaacgtgattcgcttcctctatccg
ctgactattccggaagttcagttccgtaaagcgctggatattatctaccagtcactgacc
cgctaa

DBGET integrated database retrieval system