KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_17635Help
Entry
C2U52_17635       CDS       T05417                                 

Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Pathway
ebc00564  Glycerophospholipid metabolism
ebc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C2U52_17635
Enzymes [BR:ebc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C2U52_17635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 DAO_C NAD_binding_8 3HCDH_N Thi4 HI0933_like Pyr_redox_3 SO_alpha_A3 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AUV10555
UniProt: A0A2I8QX67
LinkDB All DBs
Position
complement(3171307..3172929)
Genome map
AA seq 540 aa AA seqDB search
MGNSNDYDVIIIGGGATGAGIARDCALRGLRVVLLERHDIATGATGRNHGLLHSGARYAV
TDNESARECIAENHILKRIARHCIEPTDGLFITLPEDDLAYQPVFIDACQRAGINAQAIT
PEEARRTEPSVNPALTGAVRVPDGTVDPFRLTASNMLDAREHGATILTGHEVCGLIRQGD
RVTGVQLMNPQTHEIYPLHAPVVVNAAGIWGQRIAEYADLRIRMFPAKGALLILDHRINQ
HVINRCRKPADADILVPGDTISLIGTTSTHIDYKDIDNIRVTPEEVDILLREGEKLAPVM
AQTRILRAYAGVRPLVASDDDPTGRNVSRGIVLLDHAQRDGMEGFITITGGKLMTYRLMA
EWATDAVCRKLGLSTPCTTATTPLPGSQQPTEQALKKIISLPVPLRGSAIYRHGDRTPAS
LGSDRHSRSLVCECEAVTAGEVQYAVENLNVNSLLDLRRRTRVGMGTCQGELCACRAAGL
LHSMRVTSETESINQLCAFLNERWKGIKPVAWGDALRESEFTRWVYQGLCGLEKEPTDEI
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactcaaacgattacgatgtcatcatcatcggcggtggcgcgaccggagcaggc
atcgcccgcgactgtgcattgcgcggactgcgcgtggtactgcttgaacgccatgacatt
gccacaggtgccaccggccgcaatcacggtttattgcacagcggtgcgcgttacgcagtg
accgataacgaatccgcccgggaatgtattgcagaaaaccacatcctcaagcgtatcgct
cgccactgtattgagcctacagacggtttatttatcaccctgccggaagacgatctggct
tatcagcctgtctttattgacgcctgccagcgcgcagggattaacgcgcaggccattacg
ccagaagaagcgcggcgcacggagcccagcgtaaatccggcactgactggtgccgtccgc
gtacccgatggcactgtggatccttttcgcctgacggccagtaatatgctggatgcgcgt
gaacatggcgccactatcctgacaggccacgaagtctgcggattaatacgccagggcgac
agggtcaccggtgtacaactgatgaacccgcaaacccatgaaatttatcctctgcatgct
cctgtcgtggtcaatgccgccgggatctggggccagcgcatcgcggaatatgcggattta
cggattcgcatgttcccggccaaaggagccctgctgatactcgaccaccgtatcaatcag
catgtgataaaccgttgtcgtaaaccggcagatgccgacatcctcgtacccggcgatact
atttccctgattggcaccacctcgacgcatattgactataaggatattgacaacatccgg
gtgacgcccgaagaggtcgatattctgctgcgtgaaggggaaaagctggcgccagtgatg
gcgcagacccgtatcctgcgcgcctatgcaggcgtacgtcctttggttgccagcgatgat
gacccgacaggacgtaacgtaagccgcggcattgtgctgctcgatcacgctcaacgtgac
gggatggaaggctttatcaccattaccggcggcaagctaatgacctaccgtctgatggca
gagtgggccacagatgccgtctgccgcaagctcggtcttagcaccccttgtaccacagcg
acaacgccgttgcccggctcacagcaacctaccgaacaggcgctgaaaaaaattatctca
ctgccggtgccgctacgcggttcggctatttatcgccatggcgatcgcacgccagcctcg
ctgggcagcgatcgccacagtcgtagcctggtgtgcgaatgcgaagccgtcaccgccggg
gaagtccagtatgccgttgaaaacttgaatgttaactctctgctggatctgcgccgccgt
acccgcgtgggcatgggcacatgtcagggtgagctgtgcgcctgtcgcgcagccggctta
ctgcacagcatgcgggtgaccagtgaaacggaatctattaaccagctttgcgcatttttg
aatgagcgctggaagggcatcaaacctgtcgcctggggggatgcgctacgcgaaagtgaa
tttacacgttgggtctatcaaggactgtgcgggctggaaaaggagccaactgatgaaatt
tga

DBGET integrated database retrieval system