KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_28645Help
Entry
C2U52_28645       CDS       T05417                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Pathway
ebc00020  Citrate cycle (TCA cycle)
ebc00190  Oxidative phosphorylation
ebc00650  Butanoate metabolism
ebc01100  Metabolic pathways
ebc01110  Biosynthesis of secondary metabolites
ebc01120  Microbial metabolism in diverse environments
ebc01130  Biosynthesis of antibiotics
ebc01200  Carbon metabolism
Module
ebc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ebc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2U52_28645 (sdhB)
   00650 Butanoate metabolism
    C2U52_28645 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C2U52_28645 (sdhB)
Enzymes [BR:ebc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C2U52_28645 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     C2U52_28645 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AUV09940
UniProt: A0A2I8QUQ7
LinkDB All DBs
Position
complement(5424214..5424930)
Genome map
AA seq 238 aa AA seqDB search
MKFEFSIYRYNPDVDDAPRMQDYTLEGEEGRDMMLLDALMQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPLSALGNGKQKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDNRLEGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgagttttcaatttatcgctataacccggatgttgacgacgctccgcgcatg
caggattacaccctggaaggggaagaaggtcgtgacatgatgctgctcgatgcgttgatg
cagctaaaagaaaaagacccgagtctctctttccgtcgctcctgtcgcgaaggggtatgc
ggttcagacggcctcaacatgaacgggaaaaacggtctggcgtgtattacgccgctgtcg
gcgctgggcaacggtaagcagaagattgtgattcgcccactgccggggctgccggtaatc
cgtgatttggttgtggacatggggcaattctatgcccaatatgagaagattaagccttac
ttattgaataatgggcaaaatccacctgcgcgtgagcatctgcagatgcccgagcagcgt
gaaaaactcgatgggctgtacgaatgtatcctttgtgcatgctgctccacgtcctgtccg
tcgttctggtggaatccggataagtttatcggcccagccggtctgctggccgcgtatcgc
ttcctgattgacagtcgtgataccgagaccgataaccgcctggaagggctgagtgatgct
ttcagcgtattccgctgccatagcattatgaactgcgtcagtgtctgtccgaagggactg
aacccgacgcgcgccatcggtcatattaagtcgatgttgttgcaacgtagtgcgtaa

DBGET integrated database retrieval system